SecReT6
Protein ID: 319778110
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6390
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]338005..340770 [+]
Producttype VI secretion atpase, clpv1 family
NoteTssH
UniProt IDE8TNT7, E8TNT7
KEGG IDmci:Mesci_6390
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-39, Aligned region: 231..247
AAA_2 [PF07724], Evalue: 2.00E-39, Aligned region: 653..818
AAA [PF00004], Evalue: 1.80E-20, Aligned region: 230..362
AAA [PF00004], Evalue: 1.80E-20, Aligned region: 659..743
AAA_5 [PF07728], Evalue: 3.60E-13, Aligned region: 230..253
AAA_5 [PF07728], Evalue: 3.60E-13, Aligned region: 658..781
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 207..252
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 275..308
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 541..579
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 626..703
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 720..740
ClpB_D2-small [PF10431], Evalue: 1.80E-10, Aligned region: 826..901
AAA_22 [PF13401], Evalue: 2.60E-09, Aligned region: 229..311
AAA_22 [PF13401], Evalue: 2.60E-09, Aligned region: 343..390
AAA_22 [PF13401], Evalue: 2.60E-09, Aligned region: 657..691
AAA_25 [PF13481], Evalue: 3.40E-07, Aligned region: 212..307
AAA_25 [PF13481], Evalue: 3.40E-07, Aligned region: 656..683
AAA_25 [PF13481], Evalue: 3.40E-07, Aligned region: 836..880
Sigma54_activat [PF00158], Evalue: 1.20E-06, Aligned region: 213..244
Sigma54_activat [PF00158], Evalue: 1.20E-06, Aligned region: 658..758
AAA_14 [PF13173], Evalue: 4.60E-05, Aligned region: 230..310
AAA_14 [PF13173], Evalue: 4.60E-05, Aligned region: 657..739
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 223..250
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 658..677
AAA_19 [PF13245], Evalue: 6.70E-05, Aligned region: 230..252
AAA_19 [PF13245], Evalue: 6.70E-05, Aligned region: 655..680
Zeta_toxin [PF06414], Evalue: 9.60E-05, Aligned region: 230..251
Zeta_toxin [PF06414], Evalue: 9.60E-05, Aligned region: 651..698
NACHT [PF05729], Evalue: 0.00012, Aligned region: 230..257
NACHT [PF05729], Evalue: 0.00012, Aligned region: 658..685
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 208..247
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 282..314
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 655..679
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 726..740
AAA_17 [PF13207], Evalue: 0.00024, Aligned region: 230..249
AAA_17 [PF13207], Evalue: 0.00024, Aligned region: 657..693
AAA_29 [PF13555], Evalue: 0.00093, Aligned region: 222..245
AAA_29 [PF13555], Evalue: 0.00093, Aligned region: 656..683
AAA_18 [PF13238], Evalue: 0.0016, Aligned region: 230..247
AAA_18 [PF13238], Evalue: 0.0016, Aligned region: 659..689
RNA_helicase [PF00910], Evalue: 0.0074, Aligned region: 231..251
RNA_helicase [PF00910], Evalue: 0.0074, Aligned region: 659..680
RNA_helicase [PF00910], Evalue: 0.0074, Aligned region: 756..777
Hpr_kinase_C [PF07475], Evalue: 0.0075, Aligned region: 230..241
Hpr_kinase_C [PF07475], Evalue: 0.0075, Aligned region: 259..283
Hpr_kinase_C [PF07475], Evalue: 0.0075, Aligned region: 655..677
Protein Sequence: 921 a.a.     [Download]
>gi|319778110|ref|YP_004134540.1| type VI secretion atpase, clpv1 family [Mesorhizobium ciceri biovar biserrulae WSM1271]
MEQRRSSQSFKRKELVGKLDPVGVRAFKAAADSAKLRGNPYVELVHFIEQLVLSDRSDVQMIIADAGLDA
SRLTADMTRAVDKLPYGATSIEEFSDHIFHAIQEAWNLATLEFGVEEVRSAHILLSCLKTPVLEGLLSKI
SGEFDKIDADAVVARFADVVEGSLEGGAAIAVPAAETPKRTMGGDSALAKFATDLTQRAREGKIDPVVGR
DPEIRQIVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIAQGDVPPTLQGVSVRMLDVGLMQAGASVKG
EFEKRLKAVIDEVQSSETPVILFIDEAHTLIGAGGAAGTGDAANLLKPALARGELRTIAATTWAEYKQHI
EKDPALTRRFQVVKIDEPSEAVAVLMLRGVAGVLEQHHKVQILDEAIEAAVGLSHRYIPARQLPDKAVSL
LDTACARVAISQHATPAEVEDIMRRRQALEVERGIIGREAAIGIEVAERQARVDTGLAESEITLAAAQQR
WDREKVLVAEILELRARLRGEGVALDAATVGADAEPAAANAEKTKVAESSETEPPKAAQTDAETQAAADP
AADLARLRALMAELAAAQGETPLILPSVDRNAVAAVVQDWTGIPTGRMLSSQTEKALKLAATLSERVVGQ
DHAMEMIAKRVQTSRAGLGAPEKPVGVFLLCGPSGVGKTETALALAETLYGGEQNLISINMSEFQEAHTV
STLKGAPPGYVGYGKGGILTEAVRRKPYSVILLDEVEKAHPDVHEIFFQVFDKGMMDDSEGRRIDFKNTL
ILLTSNVGSEVIMDRTRNGTLRTGLDDLDTALRSPLLKVFPAAFLGRVVTIPYYPLSDSMIEAITGHQFA
KIARRLRATNDAELVIGDGVMDLVKARCTEIESGGRMIDAILTNTLLPELSRGVLNRSLEGEKMTKVTVG
ASKEGFTYSFE
 
Nucleotide Sequence: 2766 bp     [Download]
>gi|319777789|ref|NC_014918.1|:338005-340770 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGGAACAGCGCCGGTCGTCGCAGAGCTTCAAGCGTAAGGAACTGGTCGGCAAGCTTGATCCTGTCGGGG
TGCGCGCCTTCAAGGCCGCGGCCGATAGCGCCAAGCTGCGCGGCAATCCTTACGTCGAACTCGTTCACTT
CATCGAGCAGCTGGTGCTTTCCGACCGCTCCGATGTGCAAATGATAATCGCCGATGCGGGACTGGATGCC
AGCCGGCTCACGGCAGATATGACCCGTGCCGTCGACAAGTTGCCCTATGGCGCAACCTCGATCGAGGAAT
TCTCCGATCATATCTTCCATGCAATCCAGGAAGCCTGGAACCTCGCGACGCTGGAGTTCGGCGTCGAGGA
AGTCCGCAGCGCCCATATTCTGCTTTCCTGCCTGAAAACCCCGGTTCTGGAAGGCCTGCTGTCGAAGATC
AGCGGCGAGTTCGACAAGATCGACGCCGATGCGGTTGTCGCGCGGTTCGCCGATGTCGTGGAAGGTTCGC
TCGAAGGCGGCGCAGCCATCGCGGTTCCCGCGGCTGAAACGCCGAAGCGGACCATGGGCGGAGATTCGGC
CTTGGCGAAATTCGCCACCGATCTGACCCAACGCGCCCGCGAGGGCAAGATCGATCCGGTCGTCGGCCGC
GATCCGGAGATCCGGCAGATAGTCGACATCCTGATGCGGCGTCGGCAAAACAACCCGATCCTGACCGGCG
AGGCCGGGGTCGGCAAGACGGCGGTCGTTGAGGGCTTTGCCTTGCGTATCGCTCAGGGCGATGTGCCGCC
CACGCTGCAAGGCGTCAGCGTGCGCATGCTCGATGTCGGATTGATGCAGGCGGGCGCCAGCGTGAAGGGC
GAATTCGAAAAACGGCTGAAGGCTGTGATCGACGAGGTTCAATCGTCCGAAACGCCGGTCATCCTGTTCA
TCGACGAGGCCCACACCTTGATTGGCGCCGGCGGTGCTGCCGGAACCGGTGATGCCGCCAATCTCTTGAA
GCCGGCGCTGGCACGGGGCGAACTTCGCACCATCGCCGCAACGACCTGGGCCGAATATAAGCAGCACATC
GAGAAAGACCCGGCGCTGACCCGCCGTTTCCAGGTGGTCAAGATCGACGAGCCGTCGGAGGCGGTGGCCG
TTCTGATGTTGCGCGGGGTGGCAGGGGTTCTGGAGCAACACCACAAGGTGCAGATACTCGACGAGGCGAT
CGAGGCAGCAGTCGGCCTGTCGCATCGCTACATCCCGGCACGGCAACTGCCTGACAAGGCGGTGAGCCTC
CTCGACACCGCCTGCGCCCGTGTCGCCATATCGCAGCATGCTACGCCAGCCGAGGTCGAGGACATCATGC
GCCGCCGCCAGGCTCTGGAGGTCGAGCGCGGCATCATCGGGCGCGAGGCCGCGATCGGCATCGAGGTGGC
TGAACGGCAGGCGCGCGTCGACACCGGGCTTGCCGAAAGCGAGATCACCCTGGCTGCGGCGCAGCAGCGT
TGGGATCGTGAAAAGGTGCTCGTCGCCGAGATACTCGAACTGCGCGCCAGGCTGCGCGGCGAGGGTGTGG
CGCTCGATGCGGCCACCGTTGGGGCCGATGCCGAACCGGCAGCGGCGAACGCAGAAAAGACCAAGGTAGC
GGAGTCGTCAGAGACTGAGCCGCCCAAGGCCGCCCAGACGGACGCGGAGACACAGGCCGCTGCCGATCCT
GCCGCCGATCTCGCCCGATTGCGCGCACTGATGGCCGAATTGGCAGCGGCACAAGGCGAGACACCGCTGA
TTCTGCCCTCGGTTGACCGCAATGCAGTGGCCGCCGTGGTCCAGGACTGGACCGGGATCCCGACCGGACG
GATGCTGTCCAGCCAGACCGAAAAAGCGCTCAAGCTCGCCGCCACGCTTTCGGAACGGGTTGTGGGGCAG
GATCACGCCATGGAGATGATCGCCAAACGCGTGCAGACCAGCCGCGCCGGGCTTGGCGCGCCTGAAAAGC
CGGTCGGGGTCTTCCTGCTTTGCGGCCCCTCGGGCGTCGGCAAGACCGAAACGGCATTGGCGCTGGCCGA
AACGCTTTACGGTGGCGAGCAGAACCTGATCTCCATCAACATGTCCGAGTTCCAGGAGGCGCACACCGTC
TCGACACTGAAGGGCGCACCGCCCGGCTATGTCGGCTACGGCAAGGGCGGCATCCTGACCGAAGCGGTGC
GCAGAAAACCCTATTCGGTGATCCTGCTCGACGAGGTCGAGAAGGCGCATCCCGACGTCCACGAAATCTT
CTTCCAGGTCTTCGACAAGGGAATGATGGACGACAGCGAGGGCCGCCGGATCGATTTCAAGAACACCCTG
ATCCTGCTCACCTCGAATGTCGGCTCCGAAGTTATCATGGACCGCACAAGGAATGGCACGCTGCGGACCG
GGCTCGACGATCTGGATACCGCCTTGCGCAGCCCATTGCTGAAGGTCTTCCCGGCTGCCTTCCTTGGCCG
GGTGGTGACCATTCCTTACTATCCGCTCTCTGATTCGATGATCGAGGCGATCACTGGCCACCAGTTCGCC
AAGATCGCTCGCCGGTTGCGGGCAACCAACGATGCGGAACTGGTGATCGGCGACGGTGTCATGGATCTGG
TCAAGGCCCGCTGCACCGAGATCGAATCCGGCGGGCGGATGATCGATGCCATCCTGACCAACACGCTGCT
GCCGGAACTGAGCCGCGGCGTGCTTAACCGGTCGCTCGAGGGCGAAAAGATGACCAAAGTCACCGTCGGC
GCCTCCAAGGAAGGTTTCACTTATTCCTTCGAGTAG