SecReT6
Protein ID: 319778876
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0708
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]730792..733617 [+]
ProductClpB protein
NoteTssH
UniProt IDE8UFN2
KEGG IDteq:TEQUI_0708
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.50E-40, Aligned region: 228..307
AAA_2 [PF07724], Evalue: 3.50E-40, Aligned region: 545..590
AAA_2 [PF07724], Evalue: 3.50E-40, Aligned region: 668..834
AAA [PF00004], Evalue: 3.80E-21, Aligned region: 229..361
AAA [PF00004], Evalue: 3.80E-21, Aligned region: 674..758
ClpB_D2-small [PF10431], Evalue: 3.70E-17, Aligned region: 210..223
ClpB_D2-small [PF10431], Evalue: 3.70E-17, Aligned region: 575..592
ClpB_D2-small [PF10431], Evalue: 3.70E-17, Aligned region: 841..919
AAA_5 [PF07728], Evalue: 4.00E-13, Aligned region: 229..252
AAA_5 [PF07728], Evalue: 4.00E-13, Aligned region: 354..396
AAA_5 [PF07728], Evalue: 4.00E-13, Aligned region: 673..791
AAA_16 [PF13191], Evalue: 4.50E-13, Aligned region: 206..250
AAA_16 [PF13191], Evalue: 4.50E-13, Aligned region: 274..308
AAA_16 [PF13191], Evalue: 4.50E-13, Aligned region: 530..530
AAA_16 [PF13191], Evalue: 4.50E-13, Aligned region: 664..718
AAA_16 [PF13191], Evalue: 4.50E-13, Aligned region: 813..852
AAA_22 [PF13401], Evalue: 2.80E-08, Aligned region: 181..194
AAA_22 [PF13401], Evalue: 2.80E-08, Aligned region: 229..309
AAA_22 [PF13401], Evalue: 2.80E-08, Aligned region: 370..395
AAA_22 [PF13401], Evalue: 2.80E-08, Aligned region: 672..696
AAA_22 [PF13401], Evalue: 2.80E-08, Aligned region: 735..758
Sigma54_activat [PF00158], Evalue: 8.10E-08, Aligned region: 223..245
Sigma54_activat [PF00158], Evalue: 8.10E-08, Aligned region: 671..787
AAA_14 [PF13173], Evalue: 1.00E-07, Aligned region: 180..202
AAA_14 [PF13173], Evalue: 1.00E-07, Aligned region: 229..309
AAA_14 [PF13173], Evalue: 1.00E-07, Aligned region: 335..395
AAA_14 [PF13173], Evalue: 1.00E-07, Aligned region: 672..761
AAA_19 [PF13245], Evalue: 3.40E-07, Aligned region: 227..251
AAA_19 [PF13245], Evalue: 3.40E-07, Aligned region: 671..695
NACHT [PF05729], Evalue: 4.70E-06, Aligned region: 229..266
NACHT [PF05729], Evalue: 4.70E-06, Aligned region: 673..700
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 211..253
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 282..326
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 670..699
AAA_29 [PF13555], Evalue: 3.80E-05, Aligned region: 221..245
AAA_29 [PF13555], Evalue: 3.80E-05, Aligned region: 671..697
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 213..250
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 673..693
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 783..806
AAA_17 [PF13207], Evalue: 8.10E-05, Aligned region: 229..249
AAA_17 [PF13207], Evalue: 8.10E-05, Aligned region: 468..494
AAA_17 [PF13207], Evalue: 8.10E-05, Aligned region: 672..709
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 228..250
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 663..713
NTPase_1 [PF03266], Evalue: 0.00067, Aligned region: 229..251
NTPase_1 [PF03266], Evalue: 0.00067, Aligned region: 280..306
NTPase_1 [PF03266], Evalue: 0.00067, Aligned region: 673..694
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 179..195
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 208..249
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 281..313
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 672..694
Hpr_kinase_C [PF07475], Evalue: 0.0023, Aligned region: 229..240
Hpr_kinase_C [PF07475], Evalue: 0.0023, Aligned region: 671..692
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 179..200
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 230..251
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 674..695
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 772..792
AAA_18 [PF13238], Evalue: 0.0033, Aligned region: 181..194
AAA_18 [PF13238], Evalue: 0.0033, Aligned region: 229..255
AAA_18 [PF13238], Evalue: 0.0033, Aligned region: 461..509
AAA_18 [PF13238], Evalue: 0.0033, Aligned region: 553..594
AAA_18 [PF13238], Evalue: 0.0033, Aligned region: 674..702
T2SE [PF00437], Evalue: 0.0035, Aligned region: 214..243
T2SE [PF00437], Evalue: 0.0035, Aligned region: 668..742
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 220..304
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 645..714
AAA_28 [PF13521], Evalue: 0.005, Aligned region: 230..304
AAA_28 [PF13521], Evalue: 0.005, Aligned region: 673..693
Protein Sequence: 941 a.a.     [Download]
>gi|319778876|ref|YP_004129789.1| ClpB protein [Taylorella equigenitalis MCE9]
MSDINRTDLFGKLNTLLYRSLEGATSFCKLRGNSFVELVHWIHQILHEHDSDLQKIIRHFDLRIETVERD
VVASLDELPRGASSVSDLSEHIDSATERAWVYGSLKYGDARIRSGYLILGILKTNSLRSVLYGISSEFKK
ITPDVLAENLIDIVKNSAEEKDSVGLGQASTGASASASPQNSGKSALAQYAVDLTAKARNKEIDPVSGRD
EEIRQIVDILMRRRQNNPLLTGEAGVGKTAVVEGFALRLAKGDVPETLRDVTLYLLDIGLLQAGASMKGE
FESRLRSVIDEVQSSEKPIVLFIDEIHTLVGAGGAQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIE
KDPALTRRFQTVQVHEPNEEKALIMLRGISEPLENHHKVLLLDEAIEAAVRLSHRYIPARQLPDKAIALL
DTACARVAVSQYAEPAALEDTRRTIEYLNTEREIALREQKLGHDKSERLEEIEKELDTLEERQKELDAKW
SEEKELIKKIFELRKIIQENTDLSRKKSKSIPTEPAKNPELQADSSSEEASQPTEATQAEEEPKEHVSED
SKEAPKSKKLSEKELDEVRKELRDVQQKLLEKQGEYPLIFPSVDGNAVASVVADWTGIPVGRMVKNEANS
ILTLADTLEKRVIGQRHGLETIVKRIQTSRAKLTDPNKPVGVFLLTGPSGVGKTETALALAESLYGGEQN
LITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEKAHPDVHEIFFQVFDKGF
MEDGEGRYIDFKNTVIILTSNVGTDRIVDLCKDPELMPDVDGLTNALREPLLKTFPAALLGRLVVVPYFP
LSDEMLGNIVKLQLRRIEKRLKENHNIDFKVTDEAIKLIVSRCTQVESGGRMVDAILTNTVLPNVSHKIL
EGTTSGQTITSLSLDAKDGEFVYDYTEVPNK
 
Nucleotide Sequence: 2826 bp     [Download]
>gi|319778189|ref|NC_014914.1|:730792-733617 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGTCTGATATCAATCGTACCGACCTCTTTGGCAAACTTAATACTTTGCTTTACCGTTCTCTTGAGGGTG
CTACTTCATTTTGCAAACTTCGCGGAAATTCATTTGTTGAACTTGTGCATTGGATTCATCAAATTCTTCA
TGAACATGACAGTGATTTGCAAAAAATTATTCGCCATTTTGACTTGCGAATCGAAACCGTTGAGCGTGAT
GTTGTAGCATCGCTTGATGAATTACCTCGTGGTGCAAGCTCTGTTTCAGATTTATCAGAGCATATTGATA
GTGCTACTGAACGTGCGTGGGTTTATGGATCTCTAAAATATGGAGATGCTCGCATTCGCAGTGGGTACTT
GATATTGGGTATATTGAAAACAAATTCTTTACGTTCAGTACTATACGGTATCAGTTCTGAATTTAAAAAA
ATTACACCAGATGTGCTTGCAGAAAATCTAATCGATATTGTTAAAAATTCGGCTGAAGAGAAAGATTCAG
TTGGATTAGGTCAAGCATCGACTGGAGCTTCAGCCTCAGCATCGCCTCAAAATTCTGGAAAATCTGCATT
AGCTCAATATGCTGTTGACCTTACAGCAAAAGCTCGCAATAAGGAAATCGACCCTGTTTCTGGTCGTGAT
GAGGAGATTCGTCAAATTGTAGATATTTTGATGAGACGTCGTCAAAATAACCCACTACTTACTGGTGAAG
CGGGTGTAGGTAAAACAGCAGTCGTTGAGGGATTTGCACTACGCCTTGCTAAAGGTGATGTACCAGAGAC
TTTGCGTGATGTAACTTTATACCTACTTGATATTGGCTTGCTTCAAGCAGGGGCAAGCATGAAAGGTGAG
TTCGAATCTCGTTTAAGATCTGTGATTGATGAGGTTCAATCAAGTGAAAAACCTATAGTTTTATTTATAG
ACGAAATCCATACACTTGTAGGGGCTGGTGGTGCTCAGGGAACTGGGGATGCAGCTAACCTTTTAAAACC
AGCTCTAGCACGTGGTCAGCTAAGAACTATCGGTGCTACAACTTGGGCTGAATATAAAAAATATATCGAA
AAAGACCCAGCATTGACACGACGCTTTCAAACAGTTCAAGTCCACGAGCCAAATGAAGAAAAAGCATTAA
TCATGTTGCGTGGTATCTCTGAACCATTAGAAAATCACCACAAAGTTCTTCTTCTAGATGAAGCAATCGA
AGCTGCGGTGAGACTATCACATAGATATATTCCAGCTAGACAATTGCCAGACAAAGCCATTGCCCTCCTA
GATACGGCATGTGCACGTGTGGCTGTTAGCCAATATGCTGAGCCTGCAGCTTTAGAAGATACACGTAGAA
CCATAGAGTATTTAAACACAGAGCGTGAAATTGCATTACGTGAACAAAAACTTGGTCACGATAAATCTGA
ACGCCTCGAAGAAATCGAGAAAGAGCTTGATACACTTGAAGAGCGTCAAAAAGAATTAGATGCAAAATGG
AGCGAAGAGAAAGAGCTAATTAAGAAAATCTTTGAACTTCGCAAAATTATCCAAGAAAATACAGACCTTT
CTCGTAAAAAATCGAAAAGTATCCCTACAGAACCTGCTAAAAATCCTGAACTTCAAGCGGACTCCTCATC
TGAAGAAGCATCTCAACCTACAGAAGCAACACAAGCCGAAGAAGAGCCTAAGGAACATGTTAGTGAGGAT
TCAAAAGAAGCACCTAAGTCTAAAAAACTTTCCGAGAAAGAGCTTGATGAAGTACGCAAAGAACTCCGTG
ATGTACAACAAAAACTACTAGAAAAACAAGGCGAATATCCATTGATTTTCCCTTCTGTGGATGGCAATGC
AGTAGCCTCTGTAGTTGCTGACTGGACAGGCATCCCAGTTGGTCGCATGGTCAAAAACGAAGCTAATTCT
ATCCTTACATTAGCCGATACGCTTGAAAAACGTGTTATCGGACAACGTCACGGTTTAGAAACTATTGTTA
AACGTATTCAAACTTCACGTGCAAAACTTACCGACCCTAACAAACCAGTGGGTGTATTCCTTCTAACTGG
CCCATCAGGTGTTGGTAAAACTGAGACAGCTCTTGCTCTTGCAGAATCTTTATACGGTGGTGAGCAAAAT
CTTATCACTATCAACATGTCAGAGTTCCAAGAAGCTCACACTGTGTCTACATTAAAAGGTGCACCTCCAG
GGTATGTAGGCTATGGTGAGGGCGGTGTGTTGACAGAGGCGGTTCGTCGTCGTCCATACAGTGTAGTGTT
ACTTGATGAAGTTGAGAAAGCCCACCCTGACGTTCATGAAATCTTCTTCCAAGTTTTTGATAAAGGTTTT
ATGGAAGACGGAGAAGGTCGATATATCGACTTCAAAAATACAGTAATTATCCTTACTTCGAACGTAGGCA
CAGACCGTATTGTGGATTTGTGTAAGGACCCTGAGCTAATGCCTGATGTTGATGGCTTGACAAATGCACT
TCGTGAGCCATTACTTAAAACATTCCCAGCGGCATTGCTAGGACGTCTAGTTGTAGTTCCATATTTCCCT
CTATCGGATGAAATGTTGGGCAATATTGTCAAACTACAATTGCGTCGTATTGAGAAACGTCTTAAAGAAA
ACCACAATATCGACTTTAAAGTTACCGATGAAGCTATCAAGCTTATCGTTAGCCGTTGTACACAGGTTGA
GTCTGGCGGTCGTATGGTAGATGCAATTCTAACTAATACAGTATTGCCAAACGTATCACACAAAATACTT
GAGGGTACGACTAGTGGTCAAACAATTACTTCACTTTCGCTTGATGCAAAAGATGGAGAATTTGTATACG
ACTATACAGAAGTGCCTAATAAATAG