SecReT6
Protein ID: 319778880
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0712
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]737759..739111 [+]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDE8UFN6
KEGG IDteq:TEQUI_0712
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.40E-116, Aligned region: 19..442
Protein Sequence: 450 a.a.     [Download]
>gi|319778880|ref|YP_004129793.1| Uncharacterized protein ImpJ/VasE [Taylorella equigenitalis MCE9]
MSIESKVIWTEGMFLRPQHFQQQDRYLDSKQKVLLEASSTYFWGFSQLEIDQNALKENKLSILNASGIFK
DGTAFSLGPNEVPMLPLDTLTREETIYLVLPSREASRQEVSYDEGSDLLARFSVVETTLSDVSDITLGEA
PVQIGKPKFRFMPDSEIDGSWIKLPLVHYKGKNKLNIVEVDSGFIQPTLNCTFVDNPITNHLSKVVELLN
LRSTELSKRFNPNNRTSASTTYETIILGIVNRNLILFRHLYTLEYLHPEVFFRYLSMLVAELAMFHPDSI
AINKIPSYDHDALKVPLENLMSQIGDALNIVFEDAYVSIPLEDKGHGLSVGKVPDKSLFAKSQFVLAVKA
DLPGESVRKTFPQQAKLGPTNRMRDLVHLQLPGITLEHMDQVPAALPYHAGYIYFNLVKDGDMWNQFEKS
STLALHLAGEYPGLDMLFWAVKNTDKRNSK
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|319778189|ref|NC_014914.1|:737759-739111 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAGCATAGAAAGTAAAGTTATATGGACTGAGGGCATGTTCTTGCGCCCTCAGCATTTTCAACAGCAAG
ATAGATATTTAGATTCAAAGCAGAAGGTGCTTCTTGAGGCATCTTCAACTTATTTTTGGGGTTTCTCTCA
GTTAGAAATTGACCAAAACGCACTTAAGGAAAATAAACTTTCAATATTAAATGCTTCAGGTATTTTTAAG
GATGGGACAGCTTTTTCTTTGGGACCTAATGAGGTTCCTATGCTACCTTTAGATACTTTAACTAGAGAGG
AAACTATTTATTTAGTTTTACCTTCAAGAGAGGCTTCACGTCAGGAAGTTTCTTATGACGAAGGTAGCGA
TTTATTAGCTAGATTTAGTGTTGTTGAGACTACTCTATCCGATGTTTCCGATATAACTTTAGGTGAAGCA
CCTGTTCAAATAGGTAAGCCAAAATTTAGGTTTATGCCTGATTCTGAAATCGATGGAAGTTGGATTAAGC
TTCCACTTGTTCATTACAAAGGCAAAAATAAATTAAATATAGTTGAAGTTGATAGTGGATTTATCCAACC
AACTTTAAATTGTACGTTTGTTGATAATCCTATTACCAATCATCTTTCAAAAGTAGTGGAATTATTAAAT
CTTAGGTCTACTGAGCTTTCTAAGCGCTTTAATCCTAACAATAGAACTTCGGCTAGTACTACTTACGAAA
CAATTATTCTTGGTATCGTTAATAGAAATTTAATTTTATTTAGACACTTATATACGCTTGAGTATCTGCA
CCCAGAGGTGTTCTTCAGATACTTATCTATGTTGGTAGCAGAACTTGCAATGTTCCATCCAGATAGCATT
GCCATAAATAAAATCCCTTCTTATGACCACGACGCATTAAAAGTTCCACTTGAAAATCTTATGAGTCAGA
TAGGTGATGCACTTAATATCGTATTTGAAGATGCATACGTATCTATACCGCTTGAAGATAAAGGGCATGG
TCTTAGTGTGGGTAAAGTACCAGACAAAAGCCTTTTTGCAAAATCGCAATTTGTACTTGCTGTCAAAGCG
GATTTGCCAGGAGAGTCTGTACGCAAGACATTCCCTCAACAAGCAAAACTTGGACCTACAAATCGTATGC
GCGATCTTGTACATTTACAACTTCCAGGTATTACGCTTGAGCATATGGATCAAGTTCCTGCAGCATTGCC
ATACCATGCGGGTTATATCTACTTTAACCTAGTAAAAGATGGAGATATGTGGAATCAATTTGAAAAATCT
TCAACATTGGCACTGCATTTGGCGGGTGAATATCCTGGACTTGATATGTTATTCTGGGCTGTTAAAAACA
CTGACAAACGTAATTCGAAGTGA