SecReT6
Protein ID: 319778885
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0717
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]747609..748670 [+]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDE8UFP1
KEGG IDteq:TEQUI_0717
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.60E-14, Aligned region: 52..111
Protein Sequence: 353 a.a.     [Download]
>gi|319778885|ref|YP_004129798.1| Uncharacterized protein ImpA [Taylorella equigenitalis MCE9]
MMNFDELFPSFDNDDCGANLEYDSDFLNLVQASVPKPEQQFGDAVIEAQPPDWAKVEKMALELCKRSCDV
RILQILTYAWTFQRGLVGYAQGIDLVHQALEKCWDSINPPLFEEDGYEDPMPRVNAISALGDLSTLGRGI
RSSKLLSDNYGNLTVREGEAIIDGSNDGFPGGKNRLSELLSQATQSENEIALAIPVAFNALQSIEDLVVE
KLGHDWRPDFPTIKSLFGSFVHLINSRPSTSSSEAVVESTEISESSTQSSDTSSDSSAKFASWREVQIKT
RADAILALEKACAYFEVYEPSHPAPFIIRRLQQAIPLNFFEMLKNLAPSGSEQFEQTWVPREEEDSSSSS
DDY
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|319778189|ref|NC_014914.1|:747609-748670 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGATGAATTTTGATGAGTTATTTCCCTCATTCGATAATGATGATTGTGGGGCCAATCTTGAGTATGATT
CAGATTTTCTGAATCTAGTACAGGCTTCTGTCCCAAAACCTGAACAGCAGTTCGGGGATGCTGTTATCGA
AGCCCAGCCGCCTGATTGGGCCAAAGTTGAAAAAATGGCATTGGAATTATGTAAGCGTTCATGTGATGTT
CGCATACTACAGATATTGACTTATGCCTGGACATTTCAACGTGGTCTCGTTGGCTATGCTCAGGGTATTG
ATTTAGTTCATCAGGCATTAGAAAAGTGTTGGGATTCTATTAATCCTCCGCTTTTTGAAGAAGATGGTTA
TGAAGATCCTATGCCTCGCGTAAATGCGATTTCGGCATTGGGTGATTTGAGCACCTTAGGTAGAGGTATT
CGTAGTTCAAAACTTTTATCGGATAACTACGGTAATTTAACTGTACGTGAAGGTGAAGCCATCATCGATG
GAAGTAACGATGGGTTTCCAGGTGGAAAAAATCGATTGTCTGAGCTTTTATCTCAAGCTACTCAATCCGA
AAATGAAATCGCTTTGGCTATTCCCGTTGCTTTTAATGCTTTACAAAGCATAGAGGATTTAGTAGTTGAA
AAGTTGGGTCATGATTGGCGTCCAGATTTTCCAACTATTAAGTCTTTATTTGGTTCGTTTGTTCACTTAA
TTAACTCTAGACCTTCAACTAGTAGTTCGGAGGCGGTTGTTGAAAGCACTGAAATTTCAGAATCATCAAC
TCAATCAAGTGATACATCTTCTGATTCTTCAGCTAAGTTTGCTTCTTGGCGTGAGGTTCAGATTAAAACT
AGGGCGGATGCGATATTGGCATTGGAGAAGGCTTGTGCTTATTTCGAAGTTTATGAGCCTAGTCATCCAG
CACCTTTTATTATTCGCAGATTGCAGCAAGCGATTCCTCTTAATTTCTTTGAAATGCTTAAGAACCTGGC
CCCATCTGGTTCTGAGCAGTTTGAACAGACTTGGGTTCCTAGAGAAGAAGAGGATTCAAGTAGTTCTTCT
GATGATTATTAA