SecReT6
Protein ID: 319778886
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0718
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]748708..749241 [+]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDE8UFP2
KEGG IDteq:TEQUI_0718
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-60, Aligned region: 12..165
Protein Sequence: 177 a.a.     [Download]
>gi|319778886|ref|YP_004129799.1| hypothetical protein TEQUI_0718 [Taylorella equigenitalis MCE9] [TssB]
MGSRSKSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMAVMSDLTGKSTVEQPEVSERKFSEIDVDN
FDDRMKAIAPRVDVSVPNTLTGQGRLYVDLTFNSMDDFSPANIARNVEPLAKLLEARTELSNLLTYMDGK
SGAEELINKVLENPALLKSLAAAPNKSSSDDAQQDQE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|319778189|ref|NC_014914.1|:748708-749241 Taylorella equigenitalis MCE9, complete genome [TssB]
ATGGGCTCAAGAAGTAAAAGTGGTCAAAAGTTTATTGCACGTAACCGTGCACCACGTGTTCAAATTGAAT
ATGATGTAGAGATCTACGGTGCAGAGCGTAAAATTCAGCTCCCATTTGTTATGGCAGTTATGTCAGATTT
GACTGGTAAGTCTACTGTGGAACAACCTGAAGTAAGTGAACGTAAATTTAGCGAAATCGATGTAGATAAC
TTTGATGATCGCATGAAAGCAATAGCCCCTCGCGTGGATGTTTCTGTTCCAAATACTCTTACTGGTCAAG
GTAGACTTTACGTTGACCTTACTTTTAACAGTATGGATGATTTTAGCCCAGCAAACATTGCCCGTAACGT
TGAGCCTCTAGCAAAATTATTAGAAGCTAGGACTGAGCTTTCAAACTTATTAACTTATATGGATGGTAAA
TCTGGTGCTGAAGAATTGATTAACAAAGTTCTTGAAAATCCTGCTTTACTTAAATCCCTTGCTGCTGCTC
CAAACAAATCATCTTCAGATGATGCTCAACAAGATCAAGAATAG