SecReT6
Protein ID: 319778887
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0719
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]749250..750743 [+]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDE8UFP3
KEGG IDteq:TEQUI_0719
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.10E-197, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|319778887|ref|YP_004129800.1| Uncharacterized protein ImpC [Taylorella equigenitalis MCE9]
MATEALKQSQEKGTIEVEGLSSLLKKEFKPKTEEAQSAVESAVKTLAEQALSSAVTISSDSYITIQNIIA
EIDRKLSQQINVILHNEEFQKLEGAWRGLHYLVNNTETDEMLKIRFMPISKKELGRTLKRHKGTAWDQSP
IFKRIYEEEYGQFGGEPIGCIVGDYHFDHSPPDVELLGEMAKISAAAHCPFISGADPSLMQMDSWQELSN
PRDLSKIFTNTEYAAWRSLRETDDSRYLGLTLPRFLARLPYGARTNPVDEFDFEEDTEGANHNNYTWANS
AYAMAANINRSFKEYGWCTSIRGVESGGAVEGLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMP
LVHRKNSDFAAFIGAQSLQKPAEYDDPDATANARLSARLPYLFACCRFAHYLKCIVRDKVGSFTSRIEME
DWLNTWIMNYVDGDPANSSQETKARKPLAAAEVQVAEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKL
PSLKKAG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|319778189|ref|NC_014914.1|:749250-750743 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGGCTACTGAAGCTTTAAAACAAAGTCAAGAAAAAGGCACGATTGAAGTTGAGGGCTTATCTTCACTTC
TTAAAAAAGAATTTAAACCTAAAACAGAAGAAGCACAAAGTGCTGTTGAAAGTGCAGTTAAAACTCTAGC
TGAACAAGCACTTTCATCTGCTGTAACTATCTCCTCAGATTCATACATTACTATTCAAAATATTATTGCT
GAGATTGATCGTAAATTATCTCAACAAATTAACGTAATTCTTCATAACGAAGAGTTCCAAAAACTAGAAG
GTGCTTGGCGCGGTCTACATTACTTAGTTAATAACACTGAAACAGATGAGATGTTAAAAATCCGTTTCAT
GCCTATTTCTAAAAAAGAATTAGGTCGTACATTAAAACGTCACAAAGGTACAGCATGGGACCAAAGTCCT
ATATTCAAACGTATATACGAAGAAGAGTATGGTCAATTCGGTGGTGAACCTATCGGATGTATCGTTGGAG
ATTATCACTTCGATCACAGTCCTCCAGATGTAGAGCTTTTAGGTGAAATGGCTAAGATATCTGCTGCTGC
TCACTGCCCATTTATCTCTGGTGCTGACCCTTCACTTATGCAGATGGATTCATGGCAGGAACTTTCAAAT
CCACGTGATTTAAGCAAAATCTTCACAAATACTGAGTATGCAGCATGGAGAAGCCTACGTGAAACTGATG
ACTCACGTTATTTAGGTTTGACATTGCCTCGCTTCCTGGCTCGTCTACCATACGGTGCTCGTACTAATCC
AGTTGATGAGTTTGATTTCGAAGAAGATACAGAAGGTGCAAACCACAATAACTACACTTGGGCTAACTCT
GCATATGCGATGGCTGCAAATATCAACCGTTCATTTAAAGAGTATGGTTGGTGTACATCAATTCGTGGTG
TAGAGTCAGGTGGTGCGGTTGAAGGCTTACCTACTCACACATTCCCTACCGATGACGGTGGCGTGGATAT
GAAATGTCCAACTGAAATTGCTATTTCAGACCGTCGCGAAGCTGAACTAGCTAAAAATGGTTTCATGCCA
CTAGTTCACCGTAAAAATTCAGACTTTGCTGCGTTTATCGGAGCTCAGTCATTGCAAAAACCTGCAGAGT
ATGATGATCCTGATGCAACAGCAAATGCTCGTCTTTCTGCACGTTTACCTTATTTGTTTGCTTGCTGCCG
TTTCGCACACTACTTAAAATGCATCGTGCGTGATAAAGTGGGTTCATTTACTAGTCGTATTGAGATGGAA
GATTGGTTGAATACTTGGATTATGAACTATGTTGATGGAGATCCAGCTAACTCTTCTCAAGAAACTAAAG
CTCGTAAACCACTTGCTGCTGCTGAAGTACAAGTTGCGGAGATTGAAGATAATCCAGGCTATTATGCTGC
TAAATTCTTCTTGCGTCCGCATTATCAGTTAGAGGGTTTAACCGTTTCATTAAGGTTAGTCTCTAAACTG
CCATCCCTTAAAAAGGCTGGCTAA