SecReT6
Protein ID: 319778888
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0720
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]750811..751296 [+]
ProductUncharacterized protein ImpD
NoteTssD
UniProt IDE8UFP4
KEGG IDteq:TEQUI_0720
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-36, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|319778888|ref|YP_004129801.1| Uncharacterized protein ImpD [Taylorella equigenitalis MCE9]
MAVDMFLKISSVEGESKDSKHAKWTDIESFAWGATQPGSMATGGGGGTGKASFNDLHVICRIDRAAPTVM
KHCATGKHLDKVEISVNKAGGEQVEYSKITLEDVLVTSVQYTGEKDGDAMMVSYSFQGAKVKQQYWEQSD
KGTKGAESVVGYDIKQNKATA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|319778189|ref|NC_014914.1|:750811-751296 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGGCTGTTGATATGTTCTTAAAAATTTCAAGTGTTGAAGGTGAATCTAAAGACTCTAAACACGCTAAAT
GGACTGACATCGAATCATTCGCTTGGGGTGCTACTCAACCTGGTTCTATGGCTACTGGTGGTGGCGGCGG
TACTGGCAAAGCTAGTTTCAACGACCTTCACGTTATTTGCCGCATCGACCGTGCTGCACCTACAGTAATG
AAACATTGTGCTACTGGTAAACACTTAGACAAAGTTGAAATTTCTGTAAACAAAGCTGGTGGCGAACAAG
TTGAATACTCTAAAATCACTTTAGAAGACGTTCTTGTTACTTCAGTTCAATACACTGGTGAAAAAGATGG
CGACGCTATGATGGTTAGCTACTCTTTCCAAGGTGCTAAAGTTAAACAACAATACTGGGAGCAATCAGAT
AAAGGTACTAAAGGTGCTGAATCTGTTGTTGGTTACGACATCAAACAAAATAAAGCTACTGCTTAA