SecReT6
Protein ID: 319778889
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0721
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]751384..752217 [+]
ProductProtein of avirulence locus ImpE
NoteTagJ
UniProt IDE8UFP5
KEGG IDteq:TEQUI_0721
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.20E-35, Aligned region: 140..266
TPR_11 [PF13414], Evalue: 0.0008, Aligned region: 23..56
TPR_11 [PF13414], Evalue: 0.0008, Aligned region: 108..128
TPR_19 [PF14559], Evalue: 0.0018, Aligned region: 25..59
TPR_19 [PF14559], Evalue: 0.0018, Aligned region: 99..127
TPR_17 [PF13431], Evalue: 0.0042, Aligned region: 24..50
TPR_17 [PF13431], Evalue: 0.0042, Aligned region: 118..128
TPR_14 [PF13428], Evalue: 0.0089, Aligned region: 14..39
TPR_14 [PF13428], Evalue: 0.0089, Aligned region: 31..60
TPR_14 [PF13428], Evalue: 0.0089, Aligned region: 97..128
Protein Sequence: 277 a.a.     [Download]
>gi|319778889|ref|YP_004129802.1| Protein of avirulence locus ImpE [Taylorella equigenitalis MCE9]
MNTAGIFKTNSIDEVIEQTKDKVRKNPDSADLRANLFQLLALKGDWTRAVDSLKLSAEMNSQAQPVAMLY
VAAVNAEVDRQNVFQGNGRPAIFGDADEWMGYLIASIEEKDPSKSEELLDKAMELAPEVSGTIKTRNGEE
VNFEWLADGDSRLGPMLEFLNNGQYGWVPFNEIESLRIIEPSGISDLIWSQAELVLTNGRSIVGMVPNRY
PGDYASLDDKFNLGHRTEWVPLFESEESEYYKGVGQKTYISDLGDHPILEIESIKFNPVLTQDDAES
 
Nucleotide Sequence: 834 bp     [Download]
>gi|319778189|ref|NC_014914.1|:751384-752217 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAACACAGCTGGTATTTTTAAAACAAATTCTATTGATGAAGTTATTGAGCAAACCAAGGATAAAGTTC
GTAAGAATCCAGACAGTGCGGATTTGCGTGCAAATTTATTTCAGCTTTTAGCACTTAAAGGGGATTGGAC
TAGAGCTGTTGATTCTCTGAAACTAAGTGCTGAGATGAATTCGCAAGCACAACCCGTTGCCATGCTTTAT
GTAGCCGCTGTTAATGCTGAGGTTGACAGGCAAAACGTCTTCCAGGGTAATGGCAGACCTGCTATTTTTG
GTGATGCTGACGAGTGGATGGGGTATCTAATTGCCTCTATTGAGGAAAAGGATCCATCTAAATCTGAAGA
ATTGTTAGATAAAGCTATGGAACTTGCTCCTGAAGTATCAGGAACTATTAAGACTAGAAACGGTGAAGAA
GTTAATTTTGAATGGCTAGCAGACGGAGATAGCCGCCTAGGTCCTATGTTGGAATTTCTAAATAATGGTC
AATATGGTTGGGTACCATTTAATGAAATCGAATCGCTTCGTATCATTGAACCTTCAGGTATCTCTGATTT
AATATGGTCTCAGGCTGAATTAGTTCTTACTAACGGAAGATCTATAGTAGGCATGGTGCCTAATCGTTAT
CCTGGTGATTATGCTTCACTAGATGATAAATTCAATCTAGGACATCGTACAGAGTGGGTACCACTTTTTG
AATCAGAAGAATCAGAATACTATAAAGGTGTAGGTCAAAAGACATACATTTCTGATTTGGGCGATCACCC
AATTTTAGAAATTGAATCTATTAAATTTAATCCAGTTTTAACTCAGGATGATGCGGAAAGCTGA