SecReT6
Protein ID: 319778890
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0722
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]752228..752791 [+]
ProductUncharacterized protein ImpF
NoteTssE
UniProt IDE8UFP6
KEGG IDteq:TEQUI_0722
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-17, Aligned region: 54..163
Protein Sequence: 187 a.a.     [Download]
>gi|319778890|ref|YP_004129803.1| Uncharacterized protein ImpF [Taylorella equigenitalis MCE9]
MITAHQKRKLDSISRKSDQDYKDKLQPVLLDKLTDEHPERRKELREAATVINFEQLKKSVLRDLGWLLNT
VNLESIESLDGYNHVKSSTINFGVFPVAGQKMSEINHIEIQNQVRNAIINFEPRILPNDLEVICELEESD
LEHYNVLSLIIKGRLWCNPHPMEFFLRTSVDLESGHMEIKDEGRGSL
 
Nucleotide Sequence: 564 bp     [Download]
>gi|319778189|ref|NC_014914.1|:752228-752791 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGATTACAGCTCATCAAAAAAGAAAACTCGATAGCATCTCTAGAAAAAGCGATCAGGATTACAAAGATA
AACTTCAGCCTGTATTGCTTGATAAACTTACTGACGAGCATCCAGAAAGACGAAAAGAACTCAGGGAAGC
TGCTACAGTTATTAATTTTGAACAACTAAAAAAGTCCGTACTTAGAGATTTAGGTTGGTTGCTAAACACT
GTTAATTTAGAATCTATTGAGTCTTTGGACGGATATAATCACGTTAAAAGTTCAACTATAAATTTTGGCG
TTTTCCCTGTAGCTGGTCAGAAAATGTCAGAAATCAATCATATTGAAATTCAGAATCAAGTAAGAAACGC
AATAATTAATTTTGAGCCTAGAATTTTACCTAATGATCTTGAAGTTATCTGTGAATTAGAAGAGTCAGAT
TTAGAACACTACAACGTGTTGTCTCTTATAATCAAGGGCAGATTATGGTGTAACCCTCATCCTATGGAGT
TTTTTCTACGTACCTCAGTTGACTTAGAGTCAGGTCACATGGAGATTAAGGACGAAGGTAGAGGATCCTT
ATAA