SecReT6
Protein ID: 319778891
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0723
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]752791..754686 [+]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDE8UFP7
KEGG IDteq:TEQUI_0723
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-189, Aligned region: 6..630
Protein Sequence: 631 a.a.     [Download]
>gi|319778891|ref|YP_004129804.1| Protein ImpG/VasA [Taylorella equigenitalis MCE9]
MENDFIEYYNRELAYIREMGREFAEQYPKVASRLGMEGIQVPDPYVERLMEGFSFLTARIHKKMDAEFPQ
FTQNLLEVLYPHYVSPTPAIGIIDFDVNSKKGDLVKGYTLPKGTVFRARTGGKECRFSTGSEVTFHPLVI
EEAEVTSSMSDLPPKLLKSFRGNKQIRSALRVQIKVVGGSNIADLKNFNKLNFFLNGEEVYTHKLLEMLM
AHTIGIVVHDHERPVRWTKFLDVKNLKHEGFETNQSLLPTDSRVFQGYRLLHEYFAFPYKYLYVSLSGIQ
QAITLPEELQKQKIKSFEVTFLFDKIAHDLEGVITAENLRLHSVPVINLFPMLANRINILPNAHEYHVVV
DKAKPLDYEIYSLTKVTVNAPGAKETKEFRPFFDVYGAEGQTIHQFYSVRREARKASLSANQISRRTGYR
GSEIFISIVDVDNPPYDNHTVFGLNIETMSTNRDLPYIFNSGGDVDFRFNVSVPVDRISFIKKPTRTRAP
IGREAYSWRLINHLNLNYLNLLDSNEESGAEAVRELLHIYSDLGDPMLARQIQGIRSIKLEPIYRRMPVR
GSIVFGRGVSIKVLVDENEFAGISPYLFGSILDQFFSRHVSINMLTELELSSLQSGLIATWKPRLGGRPT
V
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|319778189|ref|NC_014914.1|:752791-754686 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGGAAAACGATTTTATTGAGTACTACAATCGCGAGTTAGCTTATATTCGCGAAATGGGACGAGAATTTG
CTGAGCAATATCCAAAAGTTGCTAGTCGTTTGGGTATGGAGGGCATACAAGTTCCCGACCCTTATGTTGA
GCGTCTTATGGAGGGCTTTAGCTTTTTAACAGCCCGTATCCATAAAAAAATGGATGCCGAGTTTCCTCAA
TTTACACAGAATTTGCTAGAAGTTCTGTACCCACACTACGTATCACCTACACCTGCAATCGGAATAATCG
ACTTCGATGTTAATTCTAAAAAGGGGGACCTAGTAAAAGGGTATACATTGCCAAAAGGTACAGTTTTCAG
AGCTAGGACTGGTGGCAAAGAGTGCCGATTTTCTACTGGAAGTGAGGTTACATTTCACCCATTAGTAATT
GAAGAAGCTGAAGTTACATCCTCTATGAGCGACCTACCTCCTAAACTTTTAAAAAGTTTTAGAGGAAACA
AGCAAATTAGAAGTGCACTTAGAGTTCAAATCAAAGTCGTAGGCGGAAGTAATATTGCAGATTTGAAAAA
CTTCAATAAGTTGAATTTTTTTCTTAATGGCGAAGAGGTTTATACTCACAAACTCCTTGAGATGCTTATG
GCTCACACTATCGGCATAGTTGTGCACGATCATGAGAGACCAGTTAGATGGACAAAATTTCTTGATGTAA
AAAATCTCAAGCATGAGGGGTTTGAGACGAATCAATCATTATTGCCAACTGATAGCAGGGTTTTTCAGGG
ATACAGACTACTTCATGAATATTTTGCATTTCCGTACAAGTATTTATATGTAAGTTTAAGTGGGATACAG
CAAGCAATAACATTGCCAGAGGAACTGCAAAAGCAAAAGATCAAGTCTTTTGAGGTCACTTTCCTGTTCG
ATAAAATTGCACATGACCTTGAGGGTGTAATTACAGCTGAAAACTTGCGTCTACATAGTGTTCCAGTTAT
TAATTTGTTTCCTATGTTGGCTAATAGGATTAATATCCTCCCGAATGCTCATGAGTATCATGTAGTCGTG
GATAAGGCTAAACCTCTTGATTATGAAATCTACTCGCTGACTAAGGTTACGGTAAATGCTCCTGGAGCTA
AAGAGACTAAGGAATTTCGACCATTTTTTGATGTTTATGGAGCTGAAGGTCAAACTATCCATCAGTTTTA
TTCTGTTAGGCGTGAAGCACGTAAAGCATCTCTTAGTGCTAATCAAATTAGCAGAAGAACTGGTTATCGA
GGAAGTGAAATCTTTATTTCAATCGTAGATGTCGATAATCCTCCTTACGACAATCATACAGTATTTGGAC
TTAATATTGAGACGATGTCCACGAATAGGGACTTGCCATATATTTTTAACAGTGGTGGAGATGTTGATTT
TAGATTTAATGTTTCTGTTCCGGTAGATAGGATAAGTTTTATAAAAAAACCAACTCGTACAAGGGCTCCA
ATAGGCAGAGAAGCTTATTCGTGGCGGTTGATCAATCACTTAAATTTAAATTACCTTAATTTGTTAGACT
CTAATGAGGAATCTGGTGCGGAGGCGGTTAGAGAATTATTGCATATTTACTCTGACCTTGGAGATCCGAT
GTTAGCTAGACAAATTCAGGGGATTAGAAGCATTAAACTTGAGCCTATTTATAGACGTATGCCTGTCAGA
GGTTCTATAGTATTTGGTCGTGGAGTTAGTATTAAAGTATTGGTCGATGAAAATGAATTTGCAGGTATTA
GTCCTTATTTATTTGGATCAATTTTAGACCAATTCTTTTCTCGTCACGTTTCTATTAATATGCTCACAGA
GCTTGAATTGTCATCTTTGCAGTCAGGATTGATAGCTACTTGGAAACCTAGACTTGGTGGTAGGCCCACA
GTGTAA