SecReT6
Protein ID: 319778895
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0727
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]759311..760855 [+]
ProductVgrG protein
NoteTssI
UniProt IDE8UFQ1
KEGG IDteq:TEQUI_0727
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-71, Aligned region: 24..323
Phage_base_V [PF04717], Evalue: 3.80E-23, Aligned region: 364..455
Protein Sequence: 514 a.a.     [Download]
>gi|319778895|ref|YP_004129808.1| VgrG protein [Taylorella equigenitalis MCE9]
MSNRHVNVDAAVSGLKIYSFKGKEHLSKLFEYEVELVSENGHLDVRDMLGTSLTIEIEMSLLQTRYLNGR
VIGFELVGPDPDGSEYYIYKAKVVPNLWFLTKAKDYKIFQEKKAEDIIKEVLDKYSIDYEFKLSGSYRNW
EYLVQYEESPFDFISRLMEHEGMYYWFKHEKGSNKLVISDSAEAHEFLIGYQNLNYLKPTFAFMDTNEVI
SDWSHKAQVSPSKYSVIDFDFRKPSTSLDANNENQLKNDDSVEVYEWQGGYQELSDGDNYAQLRIQELQV
SQEIIEAKSNIRGVVPGYKFVLLNHPRLVENNEYLVIGAEYDVVVHAYNTNDERKDKFAINFKCIPMAVQ
FRAPRTTKIPKTTGPQTATVVGPQGEEIYTDKYGRIKVQFHWDRDGKKDENSSCWIRVSNIWANSGYGGL
FIPRIGSEVIVDFIGGNPDRPIVVGCVYNEDYMPLMNLPDEKHTSGIRTRTIQGGSDNQNFLLFRDKQGD
ELIDVQAERDMNIFVKNDFFLTVG
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|319778189|ref|NC_014914.1|:759311-760855 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGTCAAATCGCCACGTAAATGTAGATGCAGCTGTTTCAGGGTTAAAAATATACAGTTTTAAGGGCAAAG
AGCATCTTTCTAAACTATTTGAATATGAAGTTGAGCTTGTCTCTGAAAATGGTCATCTTGATGTTAGAGA
TATGCTAGGTACATCGCTTACCATTGAAATAGAGATGTCTTTGTTGCAAACTCGATATTTAAACGGTAGG
GTTATAGGATTTGAATTGGTTGGTCCAGATCCCGATGGGTCAGAATATTATATATATAAAGCTAAAGTTG
TGCCGAATTTATGGTTTCTTACTAAAGCTAAAGATTACAAAATTTTCCAAGAAAAAAAGGCTGAAGATAT
TATCAAGGAAGTTTTGGACAAATATAGCATTGATTACGAATTTAAACTTTCAGGAAGCTACCGTAATTGG
GAATACTTAGTTCAGTATGAAGAATCTCCTTTTGATTTCATATCTCGTCTAATGGAACATGAGGGTATGT
ACTATTGGTTTAAACATGAAAAAGGTTCTAATAAATTAGTCATATCTGATAGTGCTGAGGCACATGAATT
TTTAATTGGGTATCAAAACTTAAATTACTTGAAACCTACTTTTGCCTTCATGGATACAAATGAAGTCATT
TCTGACTGGAGTCATAAAGCTCAAGTATCACCGTCTAAATATTCTGTTATTGACTTTGATTTTCGCAAGC
CAAGTACGTCTTTGGATGCCAATAATGAAAATCAACTCAAAAACGACGATTCTGTAGAAGTGTATGAATG
GCAGGGTGGGTATCAAGAGCTTTCAGACGGTGATAATTATGCTCAATTACGCATTCAGGAATTGCAAGTT
AGTCAAGAGATTATAGAGGCTAAGTCTAATATTCGTGGTGTTGTACCAGGCTATAAGTTTGTACTTTTAA
ATCACCCTAGGTTAGTAGAAAATAACGAATACTTAGTTATTGGTGCTGAATACGACGTTGTTGTTCATGC
CTATAATACTAATGATGAAAGAAAAGACAAATTTGCCATTAATTTTAAATGTATTCCAATGGCAGTTCAA
TTTAGGGCACCTAGAACTACTAAGATTCCTAAAACTACAGGTCCTCAAACAGCTACAGTTGTGGGTCCTC
AAGGTGAGGAAATATACACGGATAAATATGGTCGAATTAAAGTTCAATTTCACTGGGATAGAGATGGCAA
AAAAGATGAAAATTCATCATGCTGGATTAGGGTTTCAAATATTTGGGCTAATTCTGGATACGGTGGCCTA
TTTATACCAAGAATTGGTTCTGAAGTTATTGTAGATTTTATTGGTGGTAATCCTGATCGCCCAATAGTAG
TAGGGTGTGTGTACAACGAAGATTATATGCCTTTGATGAATTTACCTGATGAAAAGCATACTTCTGGAAT
TAGAACACGCACAATACAGGGCGGAAGTGATAATCAGAATTTCCTTTTGTTTAGAGATAAACAAGGAGAT
GAGTTGATTGATGTTCAGGCTGAACGTGATATGAATATATTTGTTAAAAATGACTTTTTCTTAACGGTTG
GATAA