SecReT6
Protein ID: 319791243
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0551
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]607752..609083 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDE6V5G6
KEGG IDvpe:Varpa_0551
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-149, Aligned region: 19..442
Protein Sequence: 443 a.a.     [Download]
>gi|319791243|ref|YP_004152883.1| type VI secretion protein [Variovorax paradoxus EPS]
MSWRTKVVWSEGMLLQPQHLQQSERHADHARHVLLRSTTPYAWGFAELEIDQAALTLGKLALVRAVGIFG
DGTVFDMPAVDPLPEPIDIPSSMRDEAVVLALPLRRAGAREADAEEYEELVRHRVLESDVPDSNTAGERT
AMLQLGQLHTRLMRASEATDAWTTMGVARVVERRTDNQVQLDRGMLPPLLDVAGHAVIRAWLDELLGLLR
QRGEALAGRMTQGGTGGVAEIADFMLLQAVNRNEAIFAHLAKSAMLHPQHFFEHALGLAGDLSSFRDTRR
VARFGPYIHDDLALSFRPVMDDLRRSLSMVFEQSAIRIELHDRKHGVRVAMVTDVELQRKATFVLAVNAN
MPSEALRARFPTQVKIGPVERIRDLVNLALPGVTLTPMPVAPRQIPFHTGANYFELETRNSDLWRQLEQS
GGIAMHIAGDFPGLDLAFWAIRS
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|319790694|ref|NC_014931.1|:607752-609083 Variovorax paradoxus EPS chromosome, complete genome
ATGAGTTGGCGAACAAAAGTGGTCTGGAGCGAGGGGATGCTGTTGCAGCCCCAGCACCTGCAGCAGAGCG
AGCGTCATGCCGATCATGCGAGGCATGTGCTCTTGCGTTCGACCACGCCCTACGCCTGGGGCTTTGCCGA
ACTGGAAATCGACCAGGCGGCGCTCACGCTGGGCAAGCTGGCGCTGGTGCGCGCGGTCGGCATCTTCGGC
GACGGCACGGTGTTCGACATGCCGGCGGTCGATCCGCTGCCCGAACCCATCGACATTCCCTCTTCCATGC
GCGACGAGGCCGTGGTGCTTGCACTGCCGCTGCGCCGCGCCGGTGCGCGCGAGGCCGACGCGGAAGAATA
TGAAGAGCTGGTGCGCCACCGGGTGCTCGAGTCCGACGTGCCCGATTCCAACACCGCCGGCGAGCGCACC
GCGATGCTGCAACTCGGGCAGCTCCACACGCGCCTCATGCGCGCCAGCGAAGCCACCGACGCCTGGACCA
CCATGGGCGTCGCCCGCGTGGTCGAGCGCCGCACCGACAACCAGGTGCAGCTCGATCGCGGGATGCTCCC
GCCGCTGCTCGACGTGGCCGGCCATGCGGTCATCCGCGCATGGCTCGACGAACTGCTCGGCCTGCTGCGC
CAGCGCGGCGAGGCACTCGCCGGCCGCATGACGCAGGGCGGCACCGGCGGCGTGGCCGAGATCGCCGACT
TCATGCTGCTGCAGGCGGTGAACCGCAACGAAGCCATCTTTGCGCACCTCGCGAAGAGCGCGATGCTGCA
CCCGCAGCACTTCTTCGAACATGCGCTCGGGCTCGCTGGCGACTTGTCGAGCTTTCGCGATACGCGCCGC
GTCGCGCGCTTCGGTCCCTATATTCATGACGACCTCGCGCTGAGCTTCCGCCCGGTGATGGACGACCTGC
GCCGCAGCCTCTCGATGGTGTTCGAGCAGTCGGCCATCCGCATCGAGCTGCACGACCGCAAGCACGGCGT
GCGCGTGGCGATGGTCACGGACGTGGAACTGCAGCGCAAGGCCACCTTCGTGCTCGCGGTGAACGCCAAC
ATGCCCAGCGAGGCGCTGCGCGCGCGCTTCCCGACGCAAGTGAAGATCGGCCCGGTCGAGCGCATCCGCG
ACCTCGTGAACCTGGCCCTCCCGGGCGTCACGCTCACGCCGATGCCGGTCGCGCCGCGCCAGATTCCGTT
CCACACGGGCGCGAACTATTTCGAACTCGAAACCCGCAACAGCGACCTGTGGCGCCAGCTCGAGCAATCC
GGCGGCATCGCGATGCACATCGCCGGCGATTTCCCTGGCCTCGACCTTGCCTTCTGGGCTATTCGTTCAT
GA