SecReT6
Protein ID: 319791244
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0552
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]609312..610676 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDE6V5G7
KEGG IDvpe:Varpa_0552
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.20E-68, Aligned region: 56..261
OmpA [PF00691], Evalue: 8.40E-15, Aligned region: 325..422
Protein Sequence: 454 a.a.     [Download]
>gi|319791244|ref|YP_004152884.1| DotU family type IV/VI secretion system protein [Variovorax paradoxus EPS]
MSTPPDPFAAFESERTVIKPKPRTPAGTPPAATPAPFFGGADPTPAVEVGEIGLLNPLVSAAGKLLVLIG
KLRNLAQPPNVPALRASTADAVNQFDASARRSGVSNESVLAARYVLCTALDEAVANTPWGVQAGWNKQSL
LVQFHNETWGGEKVFQLLAKLAQDVPTHRQLLELIYSVLALGFEGRYRVVDNGRAQLDSVRQRLADLIAK
DRPAVEPELSPHWRGQGAGTVRLRESLPLWVFAAGFAFLLALAWVGMQIMLNQRSDTTYAAVSGLRVPNI
QIAPPAPPAKTPRLARFLEPEVKQGLVTVTDEADRSVVRLRGDSFFGSGSAEPMAASLPVLRRIGQALAE
VKGDVLITGHSDNQPIRSLRYPSNWHLSAARADAVKGALTTLVDPARMRSDGKADAEPVAANDTPANRAR
NRRVDIVLLTEPERIASAAPVAPAPAAPVPGATK
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|319790694|ref|NC_014931.1|:609312-610676 Variovorax paradoxus EPS chromosome, complete genome
ATGAGCACACCTCCCGACCCCTTTGCCGCCTTCGAGTCGGAGCGCACGGTCATCAAGCCCAAGCCGCGCA
CGCCCGCCGGCACGCCGCCGGCCGCGACACCCGCACCGTTTTTCGGGGGCGCCGATCCGACGCCGGCCGT
GGAAGTCGGCGAGATCGGGCTGCTCAATCCGCTGGTCTCGGCCGCGGGCAAGCTGCTGGTGCTGATCGGC
AAGCTGCGCAACCTCGCGCAGCCGCCCAACGTGCCGGCGTTGCGCGCCTCCACCGCCGATGCGGTGAACC
AGTTCGATGCCAGCGCGCGCCGTTCGGGCGTGAGCAACGAATCGGTGCTTGCCGCGCGCTACGTGCTGTG
CACCGCGCTCGACGAAGCCGTGGCCAACACGCCCTGGGGCGTGCAGGCCGGCTGGAACAAGCAGAGCCTG
CTGGTCCAGTTCCACAACGAGACCTGGGGCGGCGAAAAGGTGTTCCAGCTTCTCGCCAAGCTCGCGCAGG
ATGTGCCCACGCATCGCCAGTTGCTCGAACTCATCTACAGCGTGCTTGCGCTCGGCTTCGAGGGCCGCTA
CCGCGTGGTCGACAACGGCCGCGCGCAACTCGATTCGGTGCGCCAGCGCCTGGCCGACCTGATCGCCAAG
GACCGACCGGCTGTCGAGCCCGAGCTTTCGCCGCACTGGCGCGGGCAGGGCGCGGGCACGGTGCGGCTGC
GCGAATCGCTGCCGCTGTGGGTCTTCGCTGCGGGCTTCGCGTTCCTGCTCGCGCTCGCGTGGGTGGGCAT
GCAGATCATGCTGAACCAGCGCTCCGACACCACCTACGCCGCGGTGTCGGGCCTGCGCGTGCCCAACATC
CAGATCGCGCCACCGGCACCGCCCGCGAAGACGCCGCGCCTCGCGCGCTTCCTCGAACCTGAAGTGAAGC
AGGGCCTCGTCACCGTCACCGACGAGGCGGACCGCAGCGTGGTGCGCCTGCGCGGCGATTCCTTCTTCGG
CTCCGGCAGCGCCGAGCCGATGGCCGCCTCGCTGCCGGTGCTGCGCCGCATCGGGCAGGCGCTGGCCGAG
GTGAAGGGCGATGTGCTCATCACCGGCCACTCCGACAACCAGCCGATCCGGTCGCTGCGCTATCCATCGA
ACTGGCACCTCTCGGCTGCGCGCGCCGATGCGGTGAAGGGCGCGCTCACCACGCTGGTCGACCCCGCGCG
CATGCGCTCGGACGGCAAGGCCGACGCCGAGCCCGTGGCCGCCAACGACACGCCCGCCAACCGCGCGCGC
AACCGCCGCGTGGACATCGTGCTGCTGACCGAGCCCGAGCGCATTGCCTCCGCTGCGCCAGTGGCACCTG
CGCCGGCTGCTCCCGTTCCAGGAGCGACGAAATGA