SecReT6
Protein ID: 319791254
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0562
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]624022..624876 [+]
Productvirulence protein scie type
NoteTagJ
UniProt IDE6V5H7
KEGG IDvpe:Varpa_0562
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.00E-43, Aligned region: 139..261
Protein Sequence: 284 a.a.     [Download]
>gi|319791254|ref|YP_004152894.1| virulence protein scie type [Variovorax paradoxus EPS]
MATSSAELIKSADPVAALKALSDEVRAKPSDSKHRVFMAQLLCVLGQWERALNQLTVAAELDALAVPMKQ
VYGDAVRCEGLRAEVFAGTRTPMIFGQPDEWLALLIESLLRQGRGESELAEDLRQRAFDGAPAIAGTIDG
TPFEWLADADMRLGPVLEAFVNGKYYWIPYARLAHIKIEPPEDLRDCVWMPAHLQFENGGETLALIPTRY
EGSEKSEDGELQLARKTEWRELRPEVWAGTGQRVLGSDAGEYALMDVREILFNPVASAEAEAAPSQEGTE
SAGG
 
Nucleotide Sequence: 855 bp     [Download]
>gi|319790694|ref|NC_014931.1|:624022-624876 Variovorax paradoxus EPS chromosome, complete genome
ATGGCCACCTCTTCCGCCGAACTCATCAAGTCCGCCGACCCCGTGGCGGCGCTCAAGGCGTTGAGCGACG
AGGTGCGCGCCAAGCCCTCCGACAGCAAGCACCGCGTGTTCATGGCGCAGCTGCTCTGCGTGCTGGGGCA
GTGGGAGCGCGCGCTCAACCAGCTCACGGTCGCGGCCGAGCTCGATGCGCTCGCCGTCCCGATGAAGCAG
GTGTACGGCGATGCCGTGCGCTGCGAGGGCCTGCGCGCCGAGGTGTTCGCCGGCACGCGCACGCCGATGA
TCTTCGGCCAGCCCGACGAATGGCTGGCGCTGCTCATCGAGTCGCTGCTGCGGCAGGGGCGCGGCGAGTC
CGAGCTGGCCGAGGACCTGCGCCAGCGCGCCTTCGACGGTGCGCCCGCCATCGCGGGCACCATCGACGGC
ACGCCCTTCGAGTGGCTGGCCGATGCCGATATGCGCCTGGGCCCCGTGCTCGAAGCCTTCGTCAACGGCA
AGTACTACTGGATTCCGTATGCGCGGCTCGCGCACATCAAGATCGAGCCGCCCGAGGACCTGCGCGACTG
CGTCTGGATGCCCGCGCACCTGCAGTTCGAGAACGGCGGCGAAACCCTCGCGCTCATTCCCACGCGCTAC
GAAGGTTCCGAGAAGAGCGAAGACGGCGAGCTGCAGCTCGCACGCAAGACCGAGTGGCGCGAGCTCCGTC
CCGAGGTGTGGGCCGGCACCGGCCAGCGCGTGCTCGGCAGCGATGCCGGCGAGTACGCGCTCATGGACGT
GCGCGAGATCCTCTTCAACCCGGTCGCTTCCGCCGAAGCAGAAGCAGCACCTTCGCAGGAAGGCACCGAA
AGCGCGGGCGGCTGA