SecReT6
Protein ID: 319791255
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0563
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]624878..625393 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE6V5H8
KEGG IDvpe:Varpa_0563
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-17, Aligned region: 36..147
Protein Sequence: 171 a.a.     [Download]
>gi|319791255|ref|YP_004152895.1| type VI secretion system lysozyme-like protein [Variovorax paradoxus EPS]
MGELTAQERLQPSLLDRLVDNAPTEKREGDEKRTLTKQALRAAVLRDLSWLFNATGFGLAMDDKQYPNAA
RSVINYGLPMLSGQFTSSVQRVSMEQALKNAILQFEPRILSRTLEVELVMEGSAMDSHNSIGLQIRGMLW
AQPVPLEFLMRSRVDLEEGRIEIVDMAQNPR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|319790694|ref|NC_014931.1|:624878-625393 Variovorax paradoxus EPS chromosome, complete genome
ATGGGCGAGCTCACCGCGCAGGAGCGCCTGCAGCCCTCGCTGCTCGACCGCCTGGTCGACAACGCGCCGA
CCGAAAAACGCGAGGGCGACGAGAAGCGCACGCTCACCAAGCAGGCGCTGCGCGCGGCCGTGCTGCGCGA
CCTGAGCTGGCTCTTCAACGCCACCGGTTTCGGGCTCGCGATGGACGACAAGCAGTACCCGAATGCGGCG
CGCTCGGTCATCAACTACGGATTGCCTATGCTGTCTGGCCAGTTCACCTCGTCGGTGCAGCGTGTCAGCA
TGGAACAGGCTTTGAAGAACGCAATCCTGCAGTTCGAGCCGCGCATTTTGTCCCGCACTCTCGAAGTGGA
ACTCGTCATGGAAGGCTCGGCAATGGACTCGCACAACAGCATCGGGCTGCAGATCCGCGGCATGCTGTGG
GCGCAACCCGTACCGCTCGAGTTCCTGATGCGAAGCCGTGTAGACCTGGAAGAAGGACGCATCGAGATCG
TGGACATGGCGCAAAACCCAAGGTAA