SecReT6
Protein ID: 319791256
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0564
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]625402..627294 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDE6V5H9
KEGG IDvpe:Varpa_0564
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.00E-198, Aligned region: 5..630
Protein Sequence: 630 a.a.     [Download]
>gi|319791256|ref|YP_004152896.1| type VI secretion protein [Variovorax paradoxus EPS]
MDPRLLNLYEQELRYFRESSSEFARAFPKIAHRLGIEGQEVADPYVERLIEATAFLSARVNLKLDAEYPR
FTGHLLDIVYPNFLAPTPAMAVVSFSPDLDDANLATGPKLPRGAGLRARQAVGQNTHCEFRTSSALRIWP
MEVQRAQYFTYAPDLPLATHPQSRAIRGGLRIALRATAGLKFNQIALDDLVLHLGGAEDVAWQLQECALG
QPIGVMVRPLSPTGALQGAAQSLPASAIQPVGFEDDEALLPVTATGFSGFRLLQEYFAFPQRFQFLRIAG
LQALLATMPVTEIELVLLFSRGDAALEKLVTAENVQLHCVPVVNLFNKRLDRVPLTEGVSQFHLVPDRTR
PQDFEVHTVTEVIGHGAPGADATAAEQPFRPFYSAFHGTRHNHPAYFTTTREPRMLSVRQRTEGHRSSHI
GSEVYMQIVDPQQAPYAATLRQLAVSAMCTNRDLPLLMPLGRDNDFDCVDSFPVQRVRMVRGPSRPVSPV
VSQGLGWRVVDHLALNYLSISDSTPEQGAAALRETLMLYATHADEMRQGQVRGLLSVKSKPVARRLPLKG
PIAFGRGLEVTLEVDKDAFHGHSVFLFGAVMSRFLARHVEVNHFVETVLRVAGKGETMRWRPLCGTRQIL
 
Nucleotide Sequence: 1893 bp     [Download]
>gi|319790694|ref|NC_014931.1|:625402-627294 Variovorax paradoxus EPS chromosome, complete genome
ATGGACCCTCGGCTGCTGAACCTGTATGAACAGGAACTGCGCTACTTCCGCGAAAGCTCTTCGGAGTTTG
CGCGCGCGTTTCCGAAGATCGCGCACCGGCTGGGCATCGAGGGCCAGGAGGTCGCCGACCCGTATGTCGA
GCGGCTGATCGAGGCCACGGCCTTCCTGTCGGCGCGCGTCAACCTCAAGCTCGATGCCGAGTACCCGCGC
TTCACGGGGCACCTGCTCGACATCGTCTATCCGAACTTTCTTGCACCCACGCCCGCGATGGCGGTGGTGT
CCTTCTCGCCCGACCTCGACGACGCCAACCTCGCGACCGGCCCCAAGCTGCCACGCGGCGCCGGCCTGCG
TGCGCGCCAGGCCGTGGGGCAGAACACGCACTGCGAATTCCGCACATCGAGCGCGTTGCGCATCTGGCCG
ATGGAGGTGCAGCGCGCGCAGTACTTCACCTACGCGCCCGACCTGCCGCTGGCCACGCACCCGCAATCGC
GCGCCATCCGCGGGGGCCTGCGCATTGCACTGCGCGCGACGGCGGGGCTCAAGTTCAACCAGATCGCGCT
CGACGACCTCGTGCTGCATCTGGGCGGTGCGGAAGACGTGGCGTGGCAACTGCAGGAGTGCGCGCTGGGC
CAACCCATCGGTGTGATGGTGCGGCCCCTGTCGCCCACCGGCGCATTGCAGGGCGCGGCGCAGAGCTTGC
CGGCCAGCGCGATTCAGCCGGTCGGCTTCGAGGACGACGAGGCGCTGCTGCCGGTCACGGCCACGGGCTT
CTCGGGCTTTCGTTTGCTGCAGGAGTACTTCGCATTTCCGCAGCGCTTCCAGTTCCTGCGCATCGCGGGG
CTGCAGGCGCTGCTCGCCACGATGCCGGTCACCGAGATCGAGCTCGTGCTGCTGTTCTCGCGCGGCGATG
CGGCACTCGAAAAGCTGGTGACCGCCGAGAACGTGCAGCTGCACTGCGTGCCGGTGGTCAACCTCTTCAA
CAAGCGGCTCGATCGCGTGCCGCTCACCGAAGGCGTGAGCCAGTTCCACCTGGTGCCCGACCGCACACGG
CCGCAGGACTTCGAGGTGCATACCGTCACCGAGGTCATCGGCCACGGCGCGCCGGGTGCCGATGCGACGG
CTGCCGAGCAGCCGTTCCGGCCGTTCTACTCGGCCTTCCATGGCACGCGGCACAACCACCCCGCGTACTT
CACGACCACGCGCGAGCCGCGCATGCTGTCGGTGCGCCAGCGCACCGAGGGGCACCGCAGCAGCCACATC
GGCTCCGAGGTCTACATGCAGATCGTCGATCCGCAGCAGGCGCCGTACGCGGCCACGCTGCGGCAGCTGG
CGGTGAGCGCGATGTGCACCAACCGCGACCTGCCGCTCCTGATGCCGCTCGGCCGCGACAACGACTTCGA
TTGCGTCGACTCTTTCCCGGTGCAGCGCGTGCGCATGGTGCGCGGGCCTTCGCGGCCGGTGTCGCCGGTG
GTGAGCCAGGGGCTGGGCTGGCGGGTGGTCGATCACCTCGCGCTCAACTACCTTTCGATTTCCGACAGCA
CGCCGGAGCAGGGTGCCGCCGCGCTGCGCGAAACGCTGATGCTCTATGCCACGCATGCCGACGAGATGCG
CCAGGGCCAGGTGCGCGGCCTTCTCTCGGTGAAGAGCAAGCCGGTGGCGCGCCGCCTGCCGCTCAAGGGG
CCGATCGCATTCGGGCGCGGGCTCGAAGTGACGCTGGAGGTCGACAAGGACGCGTTCCACGGCCACAGCG
TGTTTCTCTTCGGCGCCGTGATGTCGCGCTTTCTCGCGCGCCATGTGGAGGTCAATCACTTCGTCGAGAC
CGTGCTGCGCGTGGCGGGCAAGGGCGAGACCATGCGATGGAGGCCGCTGTGCGGGACCCGGCAGATTCTG
TAG