SecReT6
Protein ID: 319791257
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0565
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]627258..628340 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDE6V5I0
KEGG IDvpe:Varpa_0565
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.90E-96, Aligned region: 25..333
Protein Sequence: 360 a.a.     [Download]
>gi|319791257|ref|YP_004152897.1| type VI secretion protein [Variovorax paradoxus EPS]
MEAAVRDPADSVATRVDNALRGWSAEPWSFDYFAVMRRLESVAATTPRWGRALLPSAEPVRVGQEPSLSF
APASFSRFEPATAYSPPRLRQHFFSYVGPNGPLPVHLSDFIRERSLNHGDPTWLAFLDSFLHRFSLHFYR
AWAQARPAVALDRPGEDRFRLQVGAFVGMGTPGRIGRDEVHDDARLHFSGWLARRVHNAESVESVLRSYF
GVPVTLERWVGHWMRVPSDEVTRLGRGESSRSMGMGAMLGTRAWDRQHRVRLHMGPLTLDQYRMFLPIGT
ARPVLQRWMQQLLGDELEWDAELVLEKAEVPVTRLGQKNGNAPRLGWASWLGQRTRAKDAADVRIGSSSM
TVRTAAGAAA
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|319790694|ref|NC_014931.1|:627258-628340 Variovorax paradoxus EPS chromosome, complete genome
ATGGAGGCCGCTGTGCGGGACCCGGCAGATTCTGTAGCCACACGCGTTGACAACGCGCTGCGCGGATGGT
CGGCAGAGCCGTGGTCGTTCGATTACTTCGCGGTGATGCGCCGGCTCGAATCGGTGGCCGCGACCACGCC
GCGCTGGGGCCGCGCGCTGCTGCCGAGCGCCGAGCCAGTACGCGTGGGGCAGGAGCCTTCGCTCTCGTTC
GCACCCGCGAGCTTCAGCCGCTTCGAGCCCGCGACCGCCTATTCGCCGCCGCGCCTGCGCCAGCACTTCT
TCAGCTACGTGGGCCCCAACGGCCCGCTGCCGGTTCACCTGAGCGACTTCATCCGCGAGCGCAGCCTGAA
CCATGGTGACCCGACCTGGCTCGCGTTTCTCGACAGCTTTTTGCATCGCTTCTCGCTGCACTTCTACCGC
GCGTGGGCGCAGGCGCGGCCCGCGGTGGCGCTCGACCGGCCGGGCGAAGACCGCTTCAGGTTGCAGGTCG
GCGCGTTCGTCGGCATGGGCACGCCGGGCCGCATCGGGCGCGACGAGGTGCACGACGATGCGCGCCTGCA
TTTCTCGGGCTGGCTCGCGCGGCGCGTGCACAACGCGGAGAGCGTGGAGTCGGTGCTGCGCAGCTACTTC
GGCGTGCCGGTGACGCTGGAGCGCTGGGTCGGCCACTGGATGCGCGTGCCATCCGACGAGGTCACGCGGC
TCGGGCGGGGCGAGAGTTCGCGCTCGATGGGCATGGGCGCGATGCTCGGCACCCGCGCGTGGGACCGGCA
GCACCGCGTGCGCCTGCACATGGGCCCGCTCACGCTGGACCAGTACCGCATGTTCCTGCCCATCGGCACC
GCGCGGCCGGTGCTGCAGCGCTGGATGCAGCAACTGCTGGGCGACGAACTCGAATGGGACGCCGAGCTGG
TGCTCGAGAAGGCCGAGGTGCCGGTCACGCGCCTCGGACAGAAGAACGGCAACGCGCCGCGCCTGGGCTG
GGCCTCGTGGCTCGGCCAGCGCACGCGTGCGAAGGACGCAGCGGACGTGCGCATCGGCAGCAGCTCGATG
ACTGTCCGGACCGCTGCAGGAGCCGCCGCATGA