SecReT6
Protein ID: 319791259
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0567
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]629741..632521 [+]
Producttype VI secretion ATPase, clpv1 family
NoteTssH
UniProt IDE6V5I2
KEGG IDvpe:Varpa_0567
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.60E-39, Aligned region: 233..312
AAA_2 [PF07724], Evalue: 3.60E-39, Aligned region: 658..824
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 235..368
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 664..748
ClpB_D2-small [PF10431], Evalue: 1.30E-14, Aligned region: 216..229
ClpB_D2-small [PF10431], Evalue: 1.30E-14, Aligned region: 831..909
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 235..259
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 663..780
AAA_16 [PF13191], Evalue: 3.00E-11, Aligned region: 35..71
AAA_16 [PF13191], Evalue: 3.00E-11, Aligned region: 212..257
AAA_16 [PF13191], Evalue: 3.00E-11, Aligned region: 279..314
AAA_16 [PF13191], Evalue: 3.00E-11, Aligned region: 655..708
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 235..316
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 368..401
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 661..690
Sigma54_activat [PF00158], Evalue: 1.70E-07, Aligned region: 229..260
Sigma54_activat [PF00158], Evalue: 1.70E-07, Aligned region: 663..782
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 235..320
AAA_14 [PF13173], Evalue: 1.40E-06, Aligned region: 662..760
NACHT [PF05729], Evalue: 1.50E-05, Aligned region: 235..321
NACHT [PF05729], Evalue: 1.50E-05, Aligned region: 664..690
Zeta_toxin [PF06414], Evalue: 2.40E-05, Aligned region: 234..258
Zeta_toxin [PF06414], Evalue: 2.40E-05, Aligned region: 655..713
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 235..274
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 663..699
AAA_19 [PF13245], Evalue: 2.60E-05, Aligned region: 234..258
AAA_19 [PF13245], Evalue: 2.60E-05, Aligned region: 661..685
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 235..259
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 665..692
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 214..256
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 662..684
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 219..257
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 663..684
AAA_29 [PF13555], Evalue: 0.00059, Aligned region: 227..251
AAA_29 [PF13555], Evalue: 0.00059, Aligned region: 660..688
AAA_25 [PF13481], Evalue: 0.00078, Aligned region: 220..259
AAA_25 [PF13481], Evalue: 0.00078, Aligned region: 287..327
AAA_25 [PF13481], Evalue: 0.00078, Aligned region: 661..688
DUF815 [PF05673], Evalue: 0.0023, Aligned region: 225..311
DUF815 [PF05673], Evalue: 0.0023, Aligned region: 663..704
NTPase_1 [PF03266], Evalue: 0.0034, Aligned region: 235..258
NTPase_1 [PF03266], Evalue: 0.0034, Aligned region: 286..312
NTPase_1 [PF03266], Evalue: 0.0034, Aligned region: 663..685
Clp_N [PF02861], Evalue: 0.0049, Aligned region: 28..70
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 235..247
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 661..681
UPF0079 [PF02367], Evalue: 0.0064, Aligned region: 235..256
UPF0079 [PF02367], Evalue: 0.0064, Aligned region: 660..691
SRP54 [PF00448], Evalue: 0.0077, Aligned region: 234..258
SRP54 [PF00448], Evalue: 0.0077, Aligned region: 662..696
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 236..256
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 664..685
Protein Sequence: 926 a.a.     [Download]
>gi|319791259|ref|YP_004152899.1| type VI secretion ATPase, clpv1 family [Variovorax paradoxus EPS]
MSEISRTALFGKLNSLAYKAIEGATVFCKMRGNPYVELEHWFAQLLQAQDSDLHRVIQHYGLDVSVIAKD
MTAALDRLPRGATAISDFSPHIENAIERAWTYATLQFGEAQVRTGYILVGMLKTQSLRNPLFNLSKQFEK
IKVEDLADNFPKVCDASPESQMRAQDGTGMGSGAPGEDSGAMAPAAMGKGDALKKFAVDLTEKAKKGEMD
PVTGRDEEIRQIVDILMRRRQNNPLLTGEAGVGKTAVVEGFAQRLARGDVPPQLKDVKLLTLDIGLLQAG
ASMKGEFEQRLRQVIDEVQSSPTPIILFIDEIHTLVGAGGAAGTGDAANLLKPALARGNLRTIGATTWAE
YKKYIEKDPALTRRFQVVQVPEPDEVKAILMLRGVASVLEKHHRVQLLDEAIEAAVKLSHRYIPARQLPD
KAVSLLDTACARVAVSQHATPPEVEDCMRRIEGLTVEQEIIGREATIGIDVTKRSAQVEALLVESKLQLE
ALNARWQEEKGLVDRLLELRSKLRAGNKPVDKDAGAATTPVRTEPVEVPGAASTSSARTDGDASSGSDAA
PAHDRAALLAELHELQAKIHAVQGESPLILPSVDEQAVASVVADWTGIPVGRMVKNEVEAVLKLADTLNQ
RVIGQKHGLEMIARRIQTSRARLDNPQKPIGVFMLCGTSGVGKTETALALAEALYGGEQNIITINMSEFQ
EAHTVSTLKGAPPGYVGYGEGGILTEAVRRRPYSVVLLDEVEKAHPDVHEIFFQVFDKGWMEDGEGRMID
FKNTIILLTTNAGSELVMSMCRDPELLPDSNALADALKAPLMKVFPPALLGRIVTIPYYPLSPDMMKKIV
RLQLGRIKKRVETNHGVPFEYTEAVIEQVVARCQDPESGGRVIDAILTNTVLPTISVEYLQRLASGGEIR
RVALDVKDADFTYAFD
 
Nucleotide Sequence: 2781 bp     [Download]
>gi|319790694|ref|NC_014931.1|:629741-632521 Variovorax paradoxus EPS chromosome, complete genome
ATGAGTGAAATCAGTCGCACCGCCCTCTTCGGCAAGCTCAACTCGCTGGCCTACAAGGCCATCGAAGGCG
CCACGGTGTTCTGCAAGATGCGGGGCAATCCGTATGTGGAACTGGAGCACTGGTTCGCCCAGCTGCTGCA
GGCGCAGGACTCCGACCTGCACCGCGTGATCCAGCACTACGGCCTCGATGTGTCGGTGATCGCCAAGGAC
ATGACGGCCGCGCTCGACCGCCTGCCCCGCGGCGCCACCGCGATCAGCGACTTTTCGCCGCACATCGAGA
ACGCCATCGAACGGGCATGGACCTACGCCACGCTGCAGTTCGGCGAGGCGCAGGTGCGCACCGGCTACAT
CCTGGTGGGCATGTTGAAGACGCAGAGCCTGCGCAACCCGCTCTTCAACCTGTCCAAGCAGTTCGAGAAG
ATCAAGGTCGAAGACCTCGCCGACAACTTCCCGAAGGTGTGCGATGCCTCGCCCGAATCTCAGATGCGTG
CGCAGGACGGCACCGGCATGGGCAGCGGCGCCCCCGGCGAAGACTCGGGCGCGATGGCGCCGGCCGCCAT
GGGCAAGGGCGATGCGCTGAAAAAATTTGCTGTCGACCTCACGGAGAAAGCCAAGAAGGGAGAGATGGAT
CCGGTGACCGGGCGGGACGAGGAAATCCGCCAGATCGTCGACATCCTCATGCGCCGCCGCCAGAACAATC
CGCTCCTGACCGGCGAGGCCGGCGTCGGCAAGACGGCGGTGGTGGAAGGCTTTGCGCAGCGCCTCGCGCG
CGGCGACGTGCCGCCGCAACTGAAGGACGTGAAGCTGCTCACGCTCGACATTGGCCTCTTGCAAGCGGGC
GCGAGCATGAAAGGCGAGTTCGAGCAGCGCCTGCGCCAGGTGATCGACGAGGTGCAGAGCTCGCCGACGC
CGATCATCCTGTTCATCGACGAGATCCACACGCTCGTGGGCGCGGGCGGCGCGGCCGGCACCGGCGATGC
AGCCAACCTGCTCAAGCCGGCGCTCGCGCGCGGCAACCTGCGCACCATCGGCGCGACCACCTGGGCCGAG
TACAAGAAGTACATCGAAAAAGACCCGGCGCTCACCCGCCGCTTCCAGGTCGTGCAGGTGCCCGAGCCCG
ACGAGGTGAAGGCGATCCTGATGCTGCGCGGCGTGGCCAGCGTGCTGGAGAAGCACCACCGCGTGCAGCT
GCTCGACGAGGCCATCGAGGCTGCAGTCAAGCTCTCGCACCGCTACATTCCCGCGCGCCAGTTGCCCGAC
AAGGCGGTGAGCTTGCTGGACACCGCATGTGCCCGCGTCGCCGTGTCGCAGCATGCGACGCCGCCCGAAG
TGGAAGACTGCATGCGCCGCATCGAAGGGCTCACGGTCGAGCAGGAAATCATCGGCCGCGAAGCCACCAT
CGGCATCGATGTGACGAAGCGCTCGGCGCAGGTGGAAGCGCTGCTGGTCGAGTCGAAACTGCAGCTCGAA
GCGCTGAATGCGCGCTGGCAGGAAGAGAAGGGACTGGTCGACCGGTTGCTGGAGCTGCGCAGCAAATTGC
GTGCGGGCAACAAGCCGGTGGACAAAGATGCTGGTGCGGCAACCACCCCCGTTCGCACTGAGCCTGTCGA
AGTGCCAGGCGCGGCTTCGACAAGCTCAGCCCGAACGGATGGAGATGCATCGAGCGGATCGGACGCTGCC
CCCGCGCACGACCGCGCCGCGCTGCTTGCCGAACTGCACGAGCTGCAGGCCAAGATTCACGCGGTGCAGG
GCGAATCGCCGCTCATCCTTCCTTCGGTCGACGAACAGGCCGTGGCCTCGGTCGTCGCGGACTGGACCGG
CATCCCGGTCGGCCGCATGGTCAAGAACGAAGTGGAAGCGGTGCTCAAGCTCGCCGACACGCTGAACCAG
CGCGTCATCGGCCAGAAGCACGGCCTGGAGATGATCGCGCGCCGCATCCAGACCTCGCGTGCGCGGCTGG
ACAACCCGCAGAAACCCATCGGCGTCTTCATGCTGTGCGGCACCTCGGGCGTGGGCAAGACCGAGACCGC
GCTTGCGCTGGCCGAGGCGCTCTATGGCGGCGAGCAGAACATCATCACCATCAACATGAGCGAGTTCCAG
GAGGCGCACACCGTCTCCACGCTCAAGGGCGCGCCGCCCGGCTACGTCGGTTATGGCGAGGGCGGCATCC
TGACCGAGGCGGTGCGCCGCCGTCCCTACAGCGTGGTGCTGCTCGACGAAGTGGAGAAGGCCCATCCCGA
CGTGCACGAGATCTTCTTCCAGGTCTTCGACAAGGGCTGGATGGAAGACGGCGAGGGCCGGATGATCGAT
TTCAAGAACACGATCATCCTGCTCACCACCAACGCCGGCAGCGAGCTCGTCATGAGCATGTGCCGCGACC
CCGAGCTGCTGCCCGATTCGAACGCACTGGCCGATGCGCTGAAGGCGCCGCTCATGAAGGTGTTCCCGCC
CGCGCTGCTGGGCCGCATCGTCACCATTCCCTATTACCCGCTGTCGCCGGACATGATGAAGAAGATCGTG
CGGCTGCAGCTGGGCCGCATCAAGAAGCGCGTGGAGACCAACCACGGCGTGCCCTTCGAATACACCGAGG
CGGTGATCGAGCAGGTGGTCGCGCGCTGCCAGGACCCGGAGTCGGGCGGCCGCGTGATCGACGCGATCCT
GACCAACACGGTGCTGCCCACCATTTCGGTCGAGTACCTGCAACGCCTGGCCTCCGGTGGAGAGATCCGC
CGCGTCGCGCTGGACGTGAAGGACGCCGACTTCACCTACGCGTTCGACTGA