SecReT6
Protein ID: 319791260
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0568
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]632573..635614 [+]
Producttype VI secretion system vgr family protein
NoteTssI
UniProt IDE6V5I3
KEGG IDvpe:Varpa_0568
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-57, Aligned region: 27..335
Phage_base_V [PF04717], Evalue: 2.30E-25, Aligned region: 416..509
Protein Sequence: 1013 a.a.     [Download]
>gi|319791260|ref|YP_004152900.1| type VI secretion system vgr family protein [Variovorax paradoxus EPS]
MADHEFRIETDSPAKDDLMFWRIVGHEALARPSAYELTVLSKNKALDAKDILGRAFDVVIEFQDKDGGKH
ERHCQGHAVRFVRAGHVGRHFEYRITLRSWFWLLTKRTNSRILQDKKILEVLDAVFEDSPIKRFKKTKAG
NVIGTHTPRRYCVQHQENDYQFLSRLLEDEGIYYWFDAHDAPGTMHLSDASDLAHEKLPVDGTLRYMPSD
ASEARHNDISRWISSRQFDTGKQASRDSDFKAIKKKLGATIDVKDDHELADFEEFEFPGGYFTGDDGENR
TKLRGDELNARRDRHWALTTWPDVTAGRSFKFEGDPDGTRNGDYVIAACTFMASHPGYESVGASMAVTQD
VRTAMAEVLRDDAVNADTLQVLEDLIASTPMLNTSQPGTSAFLITAIPLERAYRPPRLTPRVTMPGPQTA
IVVGPAGDELHVDDHGRVKVHFHWDRYDESNEKSTCWVRVSQPWGGKGWGGYFIPRIGQEVIVDFLNGDP
DRPVIVGRVYNDDQPIPYKSPTQSGFKTRSTPGGGPANYNEIMFEDKKGEENINIHAELDMSRSVERDDS
TKVDRDQSVTVKRDQTTTVVRDRKLTVENNDTTSIQQFQKLTVGQNQDNHVVGNQTTHVDADHALLVKGN
HTIDVKGKRTDSTGGNEDRFVKGNQTIAVTGNMSQKAARMTFEAGHIEFKVTGANSINWDGGAAPYTAAF
QKYSLLSNTHINMMAVGDINQTSLGSNTTVLGANTSGYIGNNTEANLGMAQSTFLGMSTDNAVGLAMSNF
LGMQIENTVAIQIISVAAIGVERKNGDLKEAPFHILKAGAGGGGGSASPRVDKLAAAFSAVSAVWGIYTG
RAGVKATFKQYEDAAVQLREAANDPACESVPGLKGRLERMANVADARLEQGRSLAGSHFGTDAAIGAGTG
AAVVGGVGGIFGPVGTVVGGVVGGAAGAVVGGPLGAVTRAASSDAGDQSDALKPLDDGSVPPEPSPANPA
PQAPAADTGPNSSQADGPTSEPDGPNSSGSGEP
 
Nucleotide Sequence: 3042 bp     [Download]
>gi|319790694|ref|NC_014931.1|:632573-635614 Variovorax paradoxus EPS chromosome, complete genome
ATGGCCGACCACGAGTTCCGCATCGAGACCGATTCACCCGCCAAGGACGACCTGATGTTCTGGCGCATCG
TGGGTCACGAGGCGCTCGCGCGCCCCTCGGCGTACGAGCTCACGGTGCTCTCGAAGAACAAGGCGCTCGA
TGCCAAGGACATCCTGGGCCGGGCGTTCGACGTGGTCATCGAGTTCCAGGACAAGGACGGCGGCAAGCAC
GAGCGGCATTGCCAGGGCCATGCGGTGCGCTTCGTGCGCGCGGGGCATGTGGGCCGGCATTTCGAATACC
GCATCACGCTGCGCTCGTGGTTCTGGCTGCTCACCAAGCGCACCAACTCGCGCATCCTGCAGGACAAGAA
GATCCTGGAGGTGCTCGATGCCGTGTTCGAAGACAGCCCGATCAAGCGCTTCAAGAAGACCAAGGCCGGC
AACGTCATCGGCACCCACACGCCCCGGCGCTACTGCGTGCAGCACCAGGAGAACGACTACCAGTTCCTCT
CGCGCCTGCTGGAGGACGAGGGCATCTACTACTGGTTCGATGCGCACGATGCGCCCGGCACCATGCACCT
GTCGGATGCGAGCGACCTTGCGCACGAGAAGCTGCCGGTGGACGGCACGCTGCGCTACATGCCCAGCGAT
GCGAGCGAGGCGCGGCACAACGATATCTCGCGCTGGATCAGCTCGCGCCAGTTCGACACCGGCAAGCAGG
CCTCGCGCGACAGCGACTTCAAGGCGATCAAGAAGAAGCTGGGCGCCACCATCGACGTGAAGGACGACCA
TGAGCTGGCCGACTTCGAGGAGTTCGAATTTCCGGGCGGCTATTTCACGGGCGACGACGGCGAGAACCGC
ACCAAGCTGCGCGGCGACGAACTCAACGCGCGCCGCGACCGTCACTGGGCGCTGACCACCTGGCCCGATG
TGACGGCCGGGCGCAGCTTCAAGTTCGAAGGCGATCCCGACGGCACGCGCAACGGCGACTACGTGATCGC
GGCCTGCACCTTCATGGCGAGCCATCCGGGCTACGAAAGCGTCGGCGCCAGCATGGCCGTGACGCAGGAC
GTGCGCACTGCGATGGCCGAGGTGCTGCGTGACGATGCGGTGAACGCCGACACGCTGCAGGTGCTGGAAG
ACCTGATCGCCAGCACGCCGATGCTCAACACCTCGCAGCCGGGCACCAGCGCATTCTTGATCACGGCGAT
CCCGCTGGAGCGCGCCTACCGGCCGCCGCGCCTCACGCCGCGCGTGACCATGCCCGGGCCGCAGACCGCC
ATCGTGGTCGGCCCGGCCGGCGACGAGCTGCACGTGGACGACCACGGCCGCGTGAAGGTGCACTTTCACT
GGGACCGCTACGACGAGAGCAACGAGAAGTCGACCTGCTGGGTGCGCGTGTCGCAGCCCTGGGGCGGCAA
GGGCTGGGGCGGGTATTTCATTCCGCGCATCGGCCAGGAGGTGATCGTCGACTTCCTGAACGGCGATCCG
GACCGGCCGGTGATCGTCGGCCGCGTCTACAACGACGACCAGCCCATTCCCTACAAGTCGCCCACGCAGA
GCGGCTTCAAGACCCGCTCCACGCCCGGGGGCGGTCCCGCGAACTACAACGAGATCATGTTCGAGGACAA
GAAGGGCGAGGAGAACATCAACATCCACGCCGAGCTGGACATGAGCCGCAGCGTGGAGCGGGACGATTCG
ACGAAGGTGGACCGCGACCAGTCGGTGACCGTCAAACGCGACCAGACCACCACGGTGGTGCGGGACCGCA
AGCTGACCGTGGAGAACAACGACACCACGAGCATCCAGCAGTTCCAGAAACTCACGGTCGGCCAGAACCA
GGACAACCACGTCGTCGGCAACCAGACCACCCATGTGGATGCCGACCACGCACTGCTCGTCAAGGGCAAT
CACACGATCGACGTCAAGGGCAAGCGCACCGACTCCACGGGCGGCAACGAGGACCGCTTCGTGAAGGGCA
ACCAGACGATCGCGGTGACCGGCAACATGAGCCAGAAGGCCGCGCGCATGACCTTCGAGGCCGGCCACAT
CGAGTTCAAGGTGACCGGCGCCAATTCGATCAACTGGGACGGCGGCGCGGCGCCCTACACCGCGGCGTTC
CAGAAATACAGCCTCTTGAGCAACACGCACATCAACATGATGGCGGTCGGCGACATCAACCAGACATCGC
TCGGCTCCAACACCACCGTGCTCGGGGCCAACACCAGCGGCTACATCGGCAACAACACCGAGGCCAACCT
GGGCATGGCGCAGTCCACCTTCCTGGGCATGAGCACCGACAACGCGGTCGGCCTGGCCATGAGCAACTTC
CTGGGCATGCAGATAGAGAACACGGTGGCCATCCAGATCATCTCGGTGGCGGCCATCGGGGTCGAGCGCA
AGAACGGCGACCTGAAGGAGGCGCCGTTCCACATCCTCAAGGCGGGCGCCGGAGGCGGTGGCGGCAGCGC
CTCGCCACGGGTGGACAAGCTGGCAGCCGCTTTTTCGGCGGTGAGCGCTGTCTGGGGCATCTATACCGGG
AGGGCCGGCGTCAAAGCCACCTTCAAGCAGTACGAGGACGCGGCCGTGCAACTGCGCGAGGCAGCCAATG
ATCCGGCGTGCGAGTCCGTGCCGGGGCTCAAGGGCCGGCTGGAGCGCATGGCCAATGTGGCCGACGCACG
CCTGGAACAGGGGCGCTCGTTGGCTGGTTCGCACTTCGGCACCGATGCGGCCATTGGCGCCGGCACCGGC
GCGGCGGTGGTGGGCGGGGTGGGGGGCATCTTCGGCCCGGTGGGCACAGTGGTCGGCGGTGTGGTGGGCG
GTGCGGCTGGTGCGGTCGTGGGCGGTCCCCTCGGGGCGGTGACGCGGGCCGCCAGCAGCGACGCGGGCGA
TCAGTCGGATGCGCTCAAGCCTCTGGACGACGGTTCGGTGCCACCGGAACCGTCGCCCGCCAATCCGGCG
CCCCAGGCACCGGCGGCCGACACCGGCCCGAACTCCTCGCAGGCCGACGGGCCGACTTCCGAACCGGACG
GTCCGAACTCGTCCGGCTCCGGCGAGCCCTGA