SecReT6
Protein ID: 319791265
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0573
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]640520..642898 [+]
Producttype VI secretion system vgr family protein
NoteTssI
UniProt IDE6V5I8
KEGG IDvpe:Varpa_0573
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-56, Aligned region: 27..335
Phage_base_V [PF04717], Evalue: 3.10E-26, Aligned region: 415..506
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 557..571
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 557..576
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 572..594
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 596..619
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 621..642
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 646..667
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 672..691
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 692..715
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 709..730
Gp5_C [PF06715], Evalue: 5.60E-22, Aligned region: 719..734
DUF2345 [PF10106], Evalue: 0.0018, Aligned region: 656..780
Protein Sequence: 792 a.a.     [Download]
>gi|319791265|ref|YP_004152905.1| type VI secretion system vgr family protein [Variovorax paradoxus EPS]
MADHEFRIESDSPANGELMFWRIVGHEALARPSTYELTVLSKNRALDAKDILGRAFDVVIEFQDKDGGVH
ERHCQGHAVRFERTGHVGRHFEYRIGLRSWFWLLCKRINSRILQDKKVLEVLDAVFEDSPIKRFKKTQTS
NVIGSHNPRRYCVQHQESDYQFLSRLLEDEGIYYWFDAHDAPGTMHLSDASDIAHDKLPVEGTLRHVASD
TTEARHNEISRWVSARQFDTGTYASRDSNFKSIKKKLEAAGGAPDKHELAEFEAFEFAGGYFSGGDADDK
GKLRGEEIVARRQRHWALTTWPDVTAGRSFTFEGDPDGARDGDYVIAACTFAASHPGYESIPHSTPRMPI
EQALREALDDDAVNAEARPALEALIASAPALRTDAQGTSAFLITALPIDVPFRPPRLTPRVVMPGPQSAI
VVGPAGEEIHADDFGRVKVHFHWDRYDKSDEKSTCWVRVSQPWAGKGWGGYFIPRIGQEVIVDFLNGDPD
RPIIVGRVYNDDQPIPFGSHTQSGFRTRSTPKGSASNCNEFRFEDKKGSEQVYLHAEKNQDIEVENDETH
WVGHDRTKTIDHDETTHVKHDRTETVDNNETITVHGQRTETVDKNETITVHMNRTETVDLNETISIGQNR
SITVGASETATVALQRTHTVGINETITVGAAQEITVGAMQAVTVGASQTINVGANQSSSIGANRSVNVGA
NLSTTVGKNESRSVGEGRTTSVGKDDSLTVGKNLVISAGDSISITTGSASITMKKDGTIVIKGKDITIDA
SGKINAKASSDIVMKGSKILQN
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|319790694|ref|NC_014931.1|:640520-642898 Variovorax paradoxus EPS chromosome, complete genome
ATGGCTGATCACGAGTTCCGTATCGAAAGCGATTCGCCCGCCAACGGCGAACTGATGTTCTGGCGCATCG
TCGGCCACGAGGCGCTCGCGCGCCCGTCGACCTACGAACTCACCGTGCTCTCGAAGAACCGCGCGCTCGA
CGCCAAGGACATCCTGGGCCGGGCGTTCGACGTGGTCATCGAGTTCCAGGACAAGGACGGCGGCGTGCAC
GAGCGCCACTGCCAGGGCCATGCGGTGCGCTTCGAGCGCACGGGCCACGTGGGGCGGCATTTCGAATACC
GCATCGGGCTGCGCTCGTGGTTCTGGCTGCTCTGCAAGCGCATCAACTCGCGCATCCTGCAGGACAAGAA
GGTGCTCGAAGTGCTCGACGCGGTGTTCGAAGACAGCCCGATCAAGCGCTTCAAGAAGACGCAGACCAGC
AACGTGATCGGCTCCCACAATCCGCGGCGCTATTGCGTGCAGCACCAGGAGAGCGACTACCAGTTTCTAT
CGCGCCTGTTGGAAGACGAAGGTATCTATTACTGGTTCGACGCGCACGACGCGCCGGGCACCATGCACCT
GTCGGACGCAAGCGACATCGCGCACGACAAGCTGCCCGTCGAGGGCACGCTGCGCCACGTGGCGAGCGAC
ACCACCGAGGCGAGGCACAACGAGATCTCGCGCTGGGTGAGCGCGCGCCAGTTCGACACCGGCACCTACG
CATCGCGGGACAGCAACTTCAAGTCGATCAAGAAGAAGCTGGAGGCCGCGGGCGGCGCGCCCGACAAGCA
CGAGTTGGCCGAGTTCGAGGCCTTCGAGTTCGCGGGCGGGTACTTCTCGGGCGGCGACGCGGACGACAAG
GGCAAGCTGCGCGGCGAAGAGATCGTCGCGCGCCGCCAGCGCCACTGGGCGCTCACCACCTGGCCCGACG
TGACCGCGGGGCGCAGCTTCACCTTCGAAGGCGACCCCGACGGCGCGCGCGACGGCGATTACGTCATCGC
GGCCTGCACCTTCGCGGCGAGCCATCCGGGCTACGAGAGCATTCCCCACAGCACGCCGCGCATGCCCATC
GAGCAGGCGCTGCGCGAAGCGCTCGACGACGATGCGGTGAATGCCGAGGCGCGGCCCGCGCTCGAAGCGC
TGATCGCCAGTGCCCCCGCGCTGCGCACCGATGCGCAGGGCACGAGCGCTTTTCTCATCACCGCGTTGCC
GATCGACGTGCCGTTCCGTCCGCCGCGCCTCACGCCCCGCGTGGTAATGCCGGGGCCGCAATCGGCCATC
GTGGTGGGGCCGGCCGGCGAGGAGATCCATGCCGACGACTTCGGCCGCGTGAAGGTGCACTTTCACTGGG
ACCGCTACGACAAGAGCGACGAAAAATCCACCTGCTGGGTCCGCGTGTCGCAGCCGTGGGCGGGCAAGGG
CTGGGGCGGATATTTCATTCCGCGCATCGGGCAGGAGGTGATCGTCGACTTCCTGAACGGCGACCCCGAC
CGGCCGATCATCGTGGGCCGCGTCTACAACGACGACCAGCCGATTCCCTTCGGCTCGCACACGCAGAGCG
GCTTTCGCACGCGCTCCACGCCCAAGGGCAGCGCCTCGAACTGCAACGAGTTCCGCTTCGAGGACAAGAA
GGGCTCGGAGCAGGTGTACCTGCACGCCGAGAAGAACCAGGACATCGAGGTCGAGAACGACGAGACGCAC
TGGGTGGGTCACGACCGCACCAAGACCATCGACCACGACGAGACCACGCACGTCAAGCACGACCGCACCG
AGACGGTCGACAACAACGAGACCATCACCGTGCATGGCCAGCGCACGGAAACCGTGGACAAGAACGAGAC
CATCACCGTCCACATGAACCGCACGGAGACGGTGGACCTGAACGAGACGATCTCCATCGGGCAGAACCGC
TCGATCACCGTGGGGGCGAGCGAGACGGCGACGGTGGCGCTGCAGCGCACGCACACGGTGGGGATCAACG
AGACCATCACCGTGGGCGCGGCGCAGGAGATCACCGTCGGCGCGATGCAGGCGGTGACGGTGGGGGCGAG
CCAGACGATCAACGTCGGCGCGAACCAGTCGAGCAGCATCGGGGCGAACCGGTCGGTGAATGTGGGGGCG
AACCTCTCCACCACCGTGGGAAAGAACGAATCGCGCAGCGTGGGCGAGGGGCGCACCACCAGCGTGGGGA
AGGACGATTCGCTCACGGTCGGCAAGAACCTCGTCATCAGCGCGGGCGACTCGATCTCGATCACGACCGG
CAGCGCGAGCATCACGATGAAGAAGGACGGGACCATCGTCATCAAGGGCAAGGACATCACGATCGACGCC
TCGGGAAAGATCAATGCGAAGGCGAGCAGCGACATCGTGATGAAGGGCTCGAAGATTTTGCAGAACTGA