SecReT6
Protein ID: 319791273
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0581
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]649130..650851 [+]
Productfha domain containing protein
NoteFha
UniProt IDE6V5J6
KEGG IDvpe:Varpa_0581
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.10E-12, Aligned region: 28..94
Protein Sequence: 573 a.a.     [Download]
>gi|319791273|ref|YP_004152913.1| fha domain containing protein [Variovorax paradoxus EPS]
MIHIAVITRQGAPAGQPIAADFGPNGGTIGRADTNTLVLDDPDRTVSRVHAQVLCRDGQYFVIDRGSNPM
QCNGVSLGSGKEAALTDGARLVVGSFELSVKMTAAAAPPSLAIPNTIMSAPAAASAGGGGDDPFADLLAG
LGSPPAPAPAASSAVKAPAPASADSLLFPDPMATGSRNAQAAQVDPFANLLGPTPSFAPAAGLGALDDFS
DLGAPPAHGKASDIDDLFGGMNSGGGIGGDPLALSPLADPLLQPNTASSADPLAALQSAAPSTPTPRSDH
LPIDQFGFTPPKAVTSPPPPPPPPPPSPPPAPAPVAAAPAEVLPQFDDITGQPIRISGPEVGNRPLEPLP
PLPSPPPPPAQRASAPAAPRAERTASDDELLAAFLRGLASTHQPPEMLTPGLMERIGSMLRSATEGTLQL
LLTRQEFKREVRAEVTMIAAQANNPLKFSPTVEVALAHLLGPGVRGFMPPEAAMRDAFNDLRAHQFGVMV
GMRAALAHVITRFAPEELEKKISAKSALDAIFAANRKAKLWDQFVALYGGIASEAEDDFHNLFGKAFLEA
YEEQMARLKSDGQ
 
Nucleotide Sequence: 1722 bp     [Download]
>gi|319790694|ref|NC_014931.1|:649130-650851 Variovorax paradoxus EPS chromosome, complete genome
ATGATCCATATCGCTGTCATCACCCGGCAAGGCGCTCCGGCGGGGCAGCCCATCGCCGCCGATTTCGGGC
CCAACGGGGGAACCATCGGCCGGGCCGACACGAACACGCTGGTGCTCGACGATCCCGACCGCACTGTGTC
GCGCGTGCATGCCCAGGTGCTGTGCCGCGATGGCCAGTACTTCGTCATCGACCGGGGCAGCAACCCGATG
CAATGCAACGGTGTGTCGCTGGGGTCCGGCAAGGAGGCCGCGCTTACCGACGGCGCGCGGCTGGTGGTCG
GCAGCTTCGAACTCAGCGTGAAGATGACGGCCGCGGCGGCTCCGCCGTCGCTGGCGATTCCCAACACCAT
CATGTCGGCGCCCGCCGCCGCATCGGCAGGTGGCGGCGGCGACGATCCGTTCGCGGATCTGCTCGCGGGG
CTCGGCTCGCCGCCGGCACCCGCGCCGGCCGCGTCCAGTGCAGTCAAGGCGCCCGCTCCCGCCAGCGCCG
ATTCGCTGCTCTTCCCCGACCCGATGGCCACCGGCTCCCGCAATGCGCAGGCCGCGCAGGTCGATCCGTT
CGCCAACCTGCTCGGGCCCACGCCGAGTTTCGCGCCGGCCGCGGGCCTCGGCGCGCTCGACGATTTCTCG
GACCTCGGCGCGCCGCCCGCGCATGGCAAGGCATCGGACATCGACGATCTCTTCGGCGGCATGAACAGCG
GCGGCGGCATCGGCGGCGATCCGCTCGCGCTGTCGCCGCTGGCCGATCCGCTGCTGCAGCCGAACACGGC
CTCCTCCGCGGACCCGCTGGCCGCATTGCAGAGCGCGGCACCGTCCACGCCGACACCGCGCTCCGATCAC
TTGCCGATCGACCAGTTCGGCTTCACGCCGCCGAAGGCGGTGACGTCTCCGCCTCCACCACCACCTCCTC
CGCCGCCTTCGCCACCACCTGCGCCCGCGCCGGTGGCCGCAGCGCCTGCGGAAGTGCTGCCGCAGTTCGA
CGACATCACGGGCCAGCCGATCCGCATCAGCGGCCCCGAGGTGGGCAACAGGCCATTGGAGCCGCTGCCT
CCGCTGCCGTCGCCACCGCCGCCGCCCGCTCAACGCGCGTCCGCACCGGCCGCGCCGCGCGCCGAGCGCA
CGGCCTCCGACGACGAACTGCTCGCCGCCTTTCTGCGCGGCCTCGCCAGCACGCACCAGCCGCCCGAGAT
GCTCACGCCCGGCCTCATGGAGCGCATCGGCTCGATGCTGCGCAGCGCCACCGAGGGCACGCTGCAGTTG
CTGCTCACGCGCCAGGAGTTCAAGCGCGAGGTGCGCGCCGAGGTCACGATGATCGCGGCACAGGCCAACA
ACCCATTGAAGTTCTCGCCCACGGTGGAAGTGGCGCTCGCGCACCTGCTCGGGCCCGGCGTGCGCGGCTT
CATGCCGCCGGAGGCCGCGATGCGCGATGCCTTCAACGACCTGCGCGCCCACCAGTTCGGCGTGATGGTG
GGCATGCGCGCAGCGCTCGCGCACGTCATCACGCGCTTCGCGCCTGAAGAGCTCGAGAAGAAGATCAGCG
CGAAGTCGGCGCTCGACGCCATCTTCGCGGCCAACCGCAAGGCCAAGCTCTGGGACCAGTTCGTCGCGCT
CTACGGCGGCATCGCGAGCGAGGCGGAAGACGATTTCCACAACCTCTTCGGCAAGGCGTTTCTCGAAGCC
TACGAAGAGCAGATGGCGCGCCTGAAGTCCGACGGACAGTGA