SecReT6
Protein ID: 319791276
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0584
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]652454..652936 [-]
Producthypothetical protein
NoteTssD
UniProt IDE6V5J9
KEGG IDvpe:Varpa_0584
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-40, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|319791276|ref|YP_004152916.1| hypothetical protein Varpa_0584 [Variovorax paradoxus EPS]
MAADMFLKLEGVDGESKDDSHKKEIDVLAWSWGASQSGTGHVGGGSGAGKVSVQDVSITKYVDSSSHLLL
LDCCNGQHIKKGTLVVRKAGATPLEYVKLTMEDILVSSIQTGGSGGEDRLTETLTLNFSKFKYEYTPQKA
DGSGDGTKETGWDIAANKKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c652936-652454 Variovorax paradoxus EPS chromosome, complete genome
ATGGCTGCAGACATGTTTTTGAAGCTCGAAGGCGTCGACGGCGAATCCAAGGACGATTCGCACAAGAAGG
AAATCGACGTTCTCGCCTGGAGCTGGGGTGCCAGCCAGTCCGGCACCGGCCACGTGGGCGGCGGCTCGGG
CGCCGGCAAGGTGAGCGTGCAGGACGTTTCGATCACCAAGTACGTCGACTCTTCCTCGCACCTGCTGCTC
CTGGATTGCTGCAATGGCCAGCACATCAAGAAGGGCACGCTGGTGGTGCGCAAGGCCGGCGCCACGCCGC
TCGAATACGTCAAGCTCACGATGGAAGACATCCTGGTGAGCAGCATCCAGACCGGCGGCAGCGGCGGTGA
AGACCGCCTGACCGAGACCCTGACGCTGAACTTCTCCAAGTTCAAGTACGAGTACACGCCCCAGAAGGCC
GACGGTTCCGGCGACGGCACCAAGGAAACGGGCTGGGACATCGCAGCCAACAAGAAGGTCTGA