SecReT6
Protein ID: 319791277
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0585
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]653074..654567 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDE6V5K0
KEGG IDvpe:Varpa_0585
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-192, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|319791277|ref|YP_004152917.1| EvpB family type VI secretion protein [Variovorax paradoxus EPS]
MAEALEQSALKDVAYAGSDFSSLLQKEFKPRSDEAKSAVEAAVLTLAQQALSNSTVIGKDVTKSIQAMIA
AIDAKLTEQVNKIIHHPDYQKLESAWRGLHYMVNNTETDEHLKIRVMDISKTDLAKSLKKFKGAAWDQSP
MFKKIYEQEYGQFGGEPFGALVGDYHFDQSPPDIELLGEMSKIAASAHAPFITGASPNLMQMESWQELAN
PRDLTKIFLTPEYAGWRSLRDSDDAKYLGLCMPRFLARTPYGANTNPVEEFDFEEDTAGADHSKYAWANA
AYAMATNINRSYKLYGWGSRIRGIESGGAVENLPLHTFPSDDGGVDQKCPTEIAISDRREAELSKAGLLS
LIHRKNSDFAAFIGAQSLHKPAEYDDPDATANANLAARLPYLFACNRFAHYLKCIVRDKVGSFKERDDMQ
RWLNKWIMNYVDGDPVNSSEETKARKPLAAAEVVVEEVEGNPGYYTSKFFLRPHYQLEGLTVSLRLVSKL
PSAKGGK
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c654567-653074 Variovorax paradoxus EPS chromosome, complete genome
ATGGCCGAAGCACTCGAGCAGAGCGCACTCAAGGACGTTGCCTATGCGGGCAGCGACTTTTCGTCGCTCC
TTCAAAAGGAATTCAAGCCGCGCAGCGACGAAGCCAAGAGCGCCGTCGAAGCCGCCGTGCTCACGCTCGC
GCAGCAGGCGCTGAGCAACAGCACCGTCATCGGCAAGGATGTGACCAAGTCGATCCAGGCCATGATCGCC
GCGATCGACGCGAAGCTCACCGAGCAGGTCAACAAGATCATTCACCACCCCGACTACCAGAAGCTCGAGA
GTGCGTGGCGCGGCCTGCACTACATGGTGAACAACACCGAGACCGACGAGCACCTGAAGATCCGGGTGAT
GGACATCTCGAAGACGGACCTCGCCAAGAGCCTGAAGAAGTTCAAGGGCGCGGCGTGGGACCAGAGCCCG
ATGTTCAAGAAGATCTACGAACAGGAATACGGTCAGTTCGGCGGCGAGCCCTTCGGCGCGCTGGTGGGCG
ACTACCACTTCGACCAGAGCCCGCCCGACATCGAGCTGCTCGGCGAGATGTCCAAGATCGCGGCCTCGGC
GCATGCGCCCTTCATCACCGGCGCGAGCCCCAACCTGATGCAGATGGAGTCATGGCAGGAGCTCGCGAAC
CCGCGCGACCTGACCAAGATCTTCCTCACGCCCGAGTACGCCGGCTGGCGGTCGCTGCGGGATTCAGACG
ACGCCAAGTACCTGGGCCTGTGCATGCCGCGCTTTCTTGCGCGCACGCCCTACGGCGCCAACACCAACCC
GGTGGAGGAGTTCGACTTCGAGGAAGACACCGCCGGCGCCGACCACAGCAAGTACGCCTGGGCCAACGCC
GCGTATGCGATGGCGACCAACATCAACCGCTCGTACAAGCTCTACGGCTGGGGTTCGCGCATCCGCGGCA
TCGAGTCGGGCGGCGCGGTGGAAAACCTGCCGCTGCACACCTTCCCGAGCGACGACGGCGGCGTGGACCA
GAAGTGCCCGACCGAAATCGCCATCAGCGACCGGCGCGAAGCCGAGCTCTCCAAGGCCGGCCTGCTCTCG
CTGATTCACCGCAAGAACTCCGACTTCGCGGCCTTCATCGGTGCGCAATCGCTGCACAAGCCGGCCGAGT
ACGACGACCCGGACGCGACGGCCAACGCCAACCTCGCGGCGCGCCTGCCCTACCTCTTTGCCTGCAACCG
CTTTGCGCACTACCTGAAGTGCATCGTGCGCGACAAGGTCGGCAGCTTCAAGGAGCGCGACGACATGCAG
CGCTGGCTCAACAAATGGATCATGAATTACGTGGACGGCGATCCCGTCAACTCGTCCGAGGAGACCAAGG
CCCGCAAGCCCCTGGCCGCGGCCGAGGTGGTGGTGGAAGAGGTCGAGGGCAACCCCGGCTACTACACCTC
CAAGTTCTTCCTGCGCCCGCACTACCAGCTCGAAGGCCTCACGGTGTCGCTGCGGCTGGTGTCCAAGCTG
CCCTCGGCCAAGGGCGGCAAGTAA