SecReT6
Protein ID: 319791278
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0586
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]654624..655139 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDE6V6E4
KEGG IDvpe:Varpa_0586
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.80E-61, Aligned region: 9..162
Protein Sequence: 171 a.a.     [Download]
>gi|319791278|ref|YP_004152918.1| type VI secretion protein [Variovorax paradoxus EPS]
MAKSSQKFIARNRAPRVQIEYDVELYGAEKKIQLPFVMGVLADLSGKPTDPLAPVADRKFLEIDVDNFDS
RMKAMKPRAAFAVENSLTGEGELKVELTFENMEDFSPAAVAKKVGALNKLLEARTQLSNLVTYMDGKNGA
EELLAKVLEDPALLQSLAATAKPEDGSKPAA
 
Nucleotide Sequence: 516 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c655139-654624 Variovorax paradoxus EPS chromosome, complete genome
ATGGCCAAGAGCAGTCAGAAATTCATCGCCCGCAACCGGGCGCCACGCGTGCAGATCGAATACGACGTCG
AACTCTACGGCGCCGAGAAGAAGATCCAGCTGCCCTTCGTGATGGGGGTGCTGGCCGACCTGTCGGGCAA
GCCCACCGATCCGCTCGCGCCCGTGGCCGATCGCAAGTTCCTCGAGATCGACGTCGACAACTTCGACTCG
CGCATGAAGGCCATGAAGCCGCGCGCCGCGTTCGCGGTGGAGAACTCGCTCACCGGCGAAGGCGAACTCA
AGGTCGAACTGACCTTCGAGAACATGGAAGATTTTTCCCCCGCGGCCGTCGCCAAGAAGGTCGGTGCGCT
CAACAAGCTGCTCGAAGCACGCACGCAGCTGTCCAACCTGGTGACCTACATGGACGGCAAGAACGGCGCC
GAGGAACTGCTGGCCAAGGTGCTGGAAGACCCGGCCCTCCTGCAGTCGCTGGCGGCTACCGCCAAGCCCG
AGGACGGCAGCAAGCCGGCCGCCTGA