SecReT6
Protein ID: 319791279
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0587
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]655206..656234 [-]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDE6V6E5
KEGG IDvpe:Varpa_0587
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 57..116
Protein Sequence: 342 a.a.     [Download]
>gi|319791279|ref|YP_004152919.1| ImpA family type VI secretion-associated protein [Variovorax paradoxus EPS]
MLTHELVEALLTPIGEASPCGDDLEYDADFTALTTSAQGKPEQQFGDTVIPAVEPEWRQVAEQSDALLRR
SKDVRPAVLLLRASTRLQGITGFVAGLELLTGLLDKFWEGIHPKLDADDDNDPTMRLNALAPLGDEAMVL
KDLYDAQVGVAPGVGAIRVRDIAVANNALNAIGGDATYSPAQIQGGLEALHAERPELIQAAIGVPGLVEK
LQALLVERTGRADVIDLAPLRSIGRMLQKACSAAIGAPDEAVADGAEGDGTQAGGAPRAAAARGEIQSRQ
DALQTLDRVIRFLEQTEPGNPAPLLIDRAKKLIGVSFLEIMANLAPGALDTIENVTGKRSSE
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c656234-655206 Variovorax paradoxus EPS chromosome, complete genome
ATGCTGACTCACGAACTTGTCGAAGCACTGCTCACGCCCATTGGCGAGGCATCGCCATGCGGGGACGATC
TGGAGTACGACGCGGACTTCACCGCGCTCACCACGTCCGCGCAGGGCAAACCCGAACAACAGTTCGGCGA
CACCGTCATCCCGGCGGTGGAGCCGGAGTGGCGCCAGGTGGCCGAGCAGTCCGATGCGCTCCTGCGCCGC
AGCAAGGACGTGCGCCCCGCGGTGCTGCTGCTGCGCGCATCGACGCGCCTGCAGGGCATCACCGGCTTCG
TCGCCGGGCTCGAGCTGCTCACCGGCCTGCTCGACAAATTCTGGGAAGGCATACATCCAAAGCTCGATGC
CGACGACGACAACGACCCGACCATGCGCCTGAACGCGCTGGCACCGCTGGGCGACGAGGCGATGGTGCTG
AAGGACCTGTACGACGCGCAGGTGGGCGTGGCCCCGGGCGTGGGCGCGATCCGCGTGCGCGACATCGCGG
TGGCCAACAACGCATTGAATGCAATCGGCGGCGACGCCACCTATTCGCCGGCGCAGATCCAGGGCGGCCT
CGAAGCGCTGCATGCCGAACGGCCCGAACTGATCCAGGCTGCCATCGGCGTGCCCGGCCTGGTCGAGAAG
CTGCAGGCGCTCTTGGTCGAGCGCACCGGCCGTGCCGACGTGATCGACCTGGCGCCGCTGCGCAGCATCG
GCCGCATGCTGCAGAAGGCCTGCAGCGCGGCCATCGGCGCACCCGATGAAGCCGTGGCCGACGGCGCTGA
AGGCGACGGCACCCAAGCCGGCGGCGCACCACGTGCCGCCGCCGCGCGCGGCGAAATCCAGAGCCGCCAG
GACGCACTGCAGACGCTGGACCGCGTGATCCGTTTTCTCGAACAGACCGAGCCCGGCAATCCCGCGCCGC
TCCTGATCGACCGCGCCAAGAAGCTCATCGGCGTGAGCTTTCTCGAAATCATGGCCAACCTCGCGCCCGG
CGCGCTGGACACGATCGAGAACGTGACCGGCAAGCGTTCGTCCGAATAG