SecReT6
Protein ID: 319791280
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0588
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]656306..656827 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE6V6E6
KEGG IDvpe:Varpa_0588
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.80E-42, Aligned region: 36..168
Protein Sequence: 173 a.a.     [Download]
>gi|319791280|ref|YP_004152920.1| type VI secretion lipoprotein [Variovorax paradoxus EPS]
MRTLGTHHSSYEGFFAAVTRRRVAGLGLAIAGLAGLTLAGCASKPVVTPVSITLVAGADANPDARGRASP
LTVRVYALKSPGPFEGADFFSLFEKDQATLGAELVQREEMLLRPGETKKLDLTLPADAKSIAVMAAFRDL
DRARWREVVPVTTGKPQTLTVNFGARQIRVDAK
 
Nucleotide Sequence: 522 bp     [Download]
>gi|319790694|ref|NC_014931.1|:656306-656827 Variovorax paradoxus EPS chromosome, complete genome
ATGCGCACGCTGGGTACACACCATTCGTCCTATGAAGGCTTCTTCGCTGCGGTAACGCGGCGCCGTGTGG
CGGGTCTCGGGCTCGCAATTGCGGGTCTGGCAGGGCTTACCCTCGCCGGCTGCGCGAGCAAACCGGTGGT
CACGCCGGTGAGCATCACGCTCGTGGCCGGCGCCGATGCCAACCCCGATGCGCGCGGCCGCGCATCGCCG
CTCACGGTGCGCGTGTATGCGCTCAAGTCGCCCGGTCCCTTCGAGGGCGCGGACTTCTTCTCGCTGTTCG
AGAAGGACCAGGCCACGCTCGGCGCCGAGCTCGTGCAGCGCGAAGAAATGCTGCTGCGCCCCGGCGAAAC
CAAGAAGCTCGACCTCACGCTGCCGGCCGATGCCAAGTCCATCGCGGTGATGGCGGCCTTCCGCGACCTC
GACCGCGCGCGCTGGCGCGAAGTGGTGCCGGTGACCACGGGCAAGCCGCAGACGCTCACGGTCAACTTCG
GCGCGCGCCAGATCCGTGTAGACGCCAAGTAA