SecReT6
Protein ID: 319793558
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2896
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3115265..3117610 [-]
Producttype VI secretion system vgr family protein
NoteTssI
UniProt IDE6V5U6
KEGG IDvpe:Varpa_2896
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-84, Aligned region: 24..326
Phage_base_V [PF04717], Evalue: 2.30E-25, Aligned region: 365..456
Protein Sequence: 781 a.a.     [Download]
>gi|319793558|ref|YP_004155198.1| type VI secretion system vgr family protein [Variovorax paradoxus EPS]
MTRTVQVHTALGAEHLKFRAMRGHEGLSRLFEFEVDMVSTSFSLDLKTLLGTSLTIELQDGGAPRFLNGT
VVRFELVGRANETGRHYIYRALVQPWLWYLTRTTDCRIFQNKSVPEVLDDVLGKYGFQFEKRLTGNYRPW
EYCVQYQESDFAFVSRLMEHEGIAYHFEHSNGAHLLVLADDTGGYARLAGYATIPYRPRDRVVNAMEPCI
DRWRISEQITSGRVMLDDFDFKKSRASLQSVQQDPKGHEHSTYEVYEWLGGYSEHGQGDAYAKVRLQELQ
CAHELASGHTNVLGMAPGYLFQMTHCPRESDNREYLVTETRYDLQEPEYSSGGSAESVCEFDFTVLPSTV
AYRPARKTPKPRTNGPQTATVVGPEEIWTDRFGRVKLQFRWDRYGQSDENSSCWVRVSSNWAGANYGTMH
MPRVGQEVIVDFIGGEPDRPIITGRVYNSDQMPPWELPANATASGILTRSSTGGAANQANMLRFEDRTGA
EQILLHAERNLDVEVEADETHTTGGTRTTLIKGHESATYQSGETRDITAGAKETITGGDTRDVAGGFGET
ISGGVNQTISGGKTRMLSGGLNDTITGGVRLAITGGFNGTIDGQEIRFVSAGRNDTINTSNTVLVNGPST
TTVTGPTVHTSPDVTFNTTNHIHNTTQHVINTTTYNTTSTTYNNLTVNYTNNSATYINNYAKSSDWRLFR
AGGVGLRISLVGMSFDVWGARLQYYAGLNAQIATVKIDTAVFSLKNKPLEVSAKGLAIANKGMLIATGGL
AAKFKVLTLVV
 
Nucleotide Sequence: 2346 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3117610-3115265 Variovorax paradoxus EPS chromosome, complete genome
ATGACGCGTACCGTTCAGGTCCACACCGCACTCGGTGCAGAGCACCTCAAATTCCGCGCCATGCGTGGGC
ACGAAGGCCTCTCGCGACTGTTCGAGTTCGAGGTGGACATGGTCAGCACGAGCTTCAGCCTCGACCTGAA
GACGCTGCTGGGCACATCGCTCACCATCGAGCTGCAGGACGGCGGCGCACCGCGTTTTCTCAACGGCACC
GTGGTGCGCTTCGAACTCGTGGGCCGCGCCAACGAAACCGGCCGCCACTACATCTACCGCGCGCTGGTGC
AGCCCTGGCTCTGGTACCTCACGCGCACCACCGACTGCCGCATCTTCCAGAACAAGAGCGTGCCCGAGGT
ACTCGACGATGTGCTGGGCAAGTACGGCTTTCAGTTCGAGAAGCGCCTGACGGGCAACTACCGCCCGTGG
GAATATTGCGTGCAGTATCAGGAGAGCGACTTCGCCTTCGTGAGCCGCCTCATGGAGCACGAAGGCATCG
CCTATCACTTCGAGCACAGCAACGGCGCGCACCTTCTGGTGCTGGCCGATGACACCGGCGGCTACGCCAG
GCTGGCGGGTTACGCGACCATTCCCTACCGTCCGCGCGACCGCGTGGTCAACGCGATGGAGCCGTGCATC
GACCGGTGGCGCATCTCCGAGCAGATCACCTCGGGCCGCGTGATGCTCGACGACTTCGATTTCAAGAAGT
CGCGCGCCTCGCTGCAAAGCGTGCAGCAAGACCCGAAGGGCCACGAGCATTCGACCTACGAAGTCTACGA
ATGGCTCGGCGGCTACAGCGAGCACGGGCAAGGCGATGCTTACGCCAAGGTCCGTCTGCAGGAGTTGCAG
TGCGCGCACGAACTGGCTTCGGGACACACCAACGTCCTGGGCATGGCACCGGGTTACCTGTTCCAGATGA
CGCACTGCCCGCGCGAGTCCGACAACCGCGAGTACCTGGTCACCGAGACTCGCTACGACCTGCAGGAGCC
CGAGTATTCGAGCGGCGGCAGCGCGGAATCGGTGTGCGAATTCGACTTCACCGTGCTGCCCTCCACTGTT
GCCTACCGCCCCGCGCGCAAGACGCCCAAGCCGCGCACCAACGGCCCGCAGACCGCCACCGTCGTCGGAC
CCGAGGAGATCTGGACCGACCGCTTCGGCCGCGTGAAGCTGCAGTTCCGCTGGGACCGCTATGGCCAGTC
CGACGAGAACAGCTCCTGCTGGGTGCGCGTGTCGAGCAACTGGGCCGGCGCCAACTACGGCACCATGCAC
ATGCCGCGCGTGGGCCAGGAAGTGATCGTCGATTTCATCGGTGGCGAACCCGATCGCCCCATCATCACCG
GCCGCGTCTACAACAGCGACCAGATGCCGCCCTGGGAGCTGCCCGCCAACGCCACGGCCAGCGGCATCCT
CACGCGCTCGAGCACCGGCGGCGCGGCCAACCAGGCCAACATGCTGCGCTTCGAAGACCGCACGGGCGCC
GAACAGATCCTGCTGCACGCCGAGCGCAACCTCGACGTGGAGGTCGAGGCCGACGAGACCCACACCACCG
GCGGCACCCGCACCACCCTGATCAAGGGCCATGAGTCGGCCACCTACCAGAGCGGCGAGACGCGCGACAT
CACCGCGGGTGCGAAGGAAACCATCACCGGCGGCGACACCCGCGACGTGGCGGGAGGCTTCGGCGAGACC
ATCAGCGGCGGCGTGAACCAGACGATCTCCGGCGGCAAGACGCGCATGCTCAGCGGCGGGCTGAACGACA
CCATCACCGGCGGCGTCCGGCTCGCCATCACCGGGGGCTTCAACGGCACCATCGACGGACAGGAAATCCG
CTTCGTGAGCGCGGGCCGCAACGACACGATCAACACCTCGAACACGGTGCTGGTCAACGGCCCCTCGACC
ACCACGGTCACCGGCCCGACGGTGCACACCTCGCCGGACGTGACCTTCAACACCACCAACCACATCCACA
ACACGACGCAGCACGTCATCAACACGACGACCTACAACACGACGTCGACCACCTACAACAACCTGACGGT
CAACTACACCAACAACTCCGCCACCTACATCAACAACTACGCCAAGAGCAGCGACTGGCGGCTGTTCCGC
GCGGGCGGGGTGGGCCTTCGCATCAGCCTGGTGGGCATGTCGTTCGACGTGTGGGGCGCGCGCCTGCAGT
ACTACGCCGGGCTCAATGCGCAGATCGCGACCGTGAAGATCGACACGGCCGTCTTCTCGCTGAAGAACAA
GCCGCTCGAAGTCAGCGCCAAGGGCCTGGCCATTGCGAACAAGGGCATGCTCATCGCCACCGGCGGCCTG
GCCGCGAAGTTCAAGGTGCTCACCCTTGTGGTTTGA