SecReT6
Protein ID: 319793560
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2898
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3117956..3119047 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDE6V5U8
KEGG IDvpe:Varpa_2898
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.70E-18, Aligned region: 54..112
ImpA-rel_N [PF06812], Evalue: 3.70E-18, Aligned region: 198..207
Protein Sequence: 363 a.a.     [Download]
>gi|319793560|ref|YP_004155200.1| ImpA family type VI secretion-associated protein [Variovorax paradoxus EPS]
MPSEIDLLQSPVEGPLPCGEDLEYDPDFMALQQATTGKREQQFGATIIPAEPPDWARVERIAGQLCERTR
DLRVLVPLTLAWTETRGLPGYVDGLRLVDFVLQTFWDEVHPRVIADGFEDPLPRMNALAALAETEGLGRS
VRDARLLDDGGSSVSLRQVEALLDSSKADQIDYPGGIGRLREAARRAHEKATPAVVALRAALELLQRIRE
TSERALGQSWAPDFSRLERSLRTVIQLLPEQAQPDPAPSLPGENDMNPQGTAQSVSSAQSTISAAASGGA
GLRAPGIKEIEISSRDDVRVLLEKACEYLERTEPSHPAPMLIRRAQRLMDLNFFQIIEELVPEGLQKIEG
LAGRPLNGGAAPE
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3117956-3119047 Variovorax paradoxus EPS chromosome, complete genome
TTGCCGAGTGAGATCGATTTGTTGCAGTCGCCTGTCGAAGGCCCGCTTCCTTGCGGCGAGGATCTGGAGT
ACGACCCCGATTTCATGGCGTTGCAACAAGCGACGACGGGCAAGCGGGAGCAACAGTTCGGAGCCACGAT
CATTCCGGCAGAGCCGCCCGACTGGGCCCGCGTGGAACGCATCGCCGGACAGCTGTGCGAACGCACGCGC
GACCTGCGGGTGCTGGTTCCGCTGACCCTGGCATGGACCGAGACGCGTGGCCTCCCCGGCTACGTCGACG
GCCTTCGGCTGGTCGACTTTGTGCTGCAGACGTTCTGGGACGAAGTGCATCCGCGCGTCATTGCCGACGG
CTTCGAAGACCCGCTGCCGCGCATGAATGCGTTGGCTGCACTGGCGGAAACCGAAGGGCTCGGACGCAGC
GTGCGAGATGCACGCCTGCTCGACGATGGTGGTTCGTCGGTGAGCCTGCGGCAGGTCGAGGCCCTGCTCG
ATTCGAGCAAGGCCGATCAGATCGACTATCCCGGCGGCATCGGCCGCTTGCGTGAAGCGGCGCGCCGCGC
GCATGAGAAAGCAACGCCCGCGGTGGTGGCCTTGCGCGCCGCGCTGGAGCTGCTGCAGCGCATTCGCGAG
ACTTCCGAACGCGCACTGGGACAAAGCTGGGCGCCTGATTTCTCCCGGCTCGAACGCTCGCTTCGCACCG
TGATCCAGCTGCTGCCCGAGCAGGCGCAGCCCGATCCGGCGCCGAGCCTTCCGGGGGAGAACGACATGAA
TCCACAAGGGACTGCGCAGTCTGTTTCGAGCGCGCAGTCCACGATCTCGGCGGCTGCAAGTGGCGGCGCA
GGCCTACGCGCACCCGGTATTAAAGAGATTGAAATATCGAGCCGTGATGATGTGCGAGTGCTGTTGGAGA
AGGCTTGCGAGTACCTGGAGCGCACGGAGCCCAGTCATCCTGCGCCCATGCTGATACGGCGAGCGCAAAG
ACTCATGGACCTCAACTTCTTCCAGATCATCGAAGAGCTTGTGCCCGAGGGATTGCAGAAGATCGAGGGA
CTTGCCGGACGGCCGTTGAACGGCGGTGCCGCGCCTGAATAG