SecReT6
Protein ID: 319793561
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2899
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3119135..3119707 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDE6V5U9
KEGG IDvpe:Varpa_2899
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-57, Aligned region: 14..166
Protein Sequence: 190 a.a.     [Download]
>gi|319793561|ref|YP_004155201.1| type VI secretion protein [Variovorax paradoxus EPS]
MADNRVRNSGQKFIARNRAPRVQIEYDVEIYGSERKIQLPFVMGVIADLAGKQMDPMPDLAERDFMEVDI
DNFDDRMKAIKPRVAFQVPNTLTGEGQMNVDITFDTMDDFSPARIAGQVGALQQLLAARTELSNLLSYMD
GKNGAEQLIAQALQNPALLKSLASAPNPAVAKAVEAANEKAGHAPGGSPE
 
Nucleotide Sequence: 573 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3119135-3119707 Variovorax paradoxus EPS chromosome, complete genome
ATGGCAGACAACCGTGTCAGAAACAGTGGTCAGAAGTTCATCGCGCGGAACCGGGCGCCGCGTGTGCAGA
TCGAGTACGACGTCGAGATCTACGGCAGCGAACGCAAGATCCAGCTGCCCTTCGTGATGGGCGTGATCGC
CGACCTCGCGGGCAAGCAGATGGACCCGATGCCCGATCTGGCCGAGCGCGATTTCATGGAAGTCGACATC
GACAACTTCGACGACCGCATGAAGGCGATCAAGCCGCGCGTGGCGTTCCAGGTGCCCAACACGCTCACGG
GCGAAGGCCAGATGAATGTCGACATCACCTTCGACACCATGGACGACTTCTCGCCCGCGCGCATCGCGGG
CCAGGTGGGCGCGTTGCAGCAGTTGCTCGCCGCACGCACCGAACTGTCGAACCTGCTCTCGTACATGGAC
GGCAAGAACGGTGCCGAGCAATTGATCGCGCAGGCCCTGCAGAACCCGGCGCTGCTCAAGTCGCTCGCTT
CCGCGCCCAACCCGGCTGTCGCCAAGGCGGTCGAAGCGGCGAACGAGAAAGCGGGCCACGCGCCCGGCGG
TTCTCCCGAGTAA