SecReT6
Protein ID: 319793562
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2900
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3119753..3121261 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDE6V5V0
KEGG IDvpe:Varpa_2900
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.70E-194, Aligned region: 71..495
Protein Sequence: 502 a.a.     [Download]
>gi|319793562|ref|YP_004155202.1| EvpB family type VI secretion protein [Variovorax paradoxus EPS]
MSTAPKQTARAQATTVEALAPNEFSDLLQREFKPKTEQAREAVQNAVKTLAVQALESTVTISNDAYRTVQ
GIITEIDRKLTEQINQILHHEDFQQLEGAWRGLHYLVNNTETDEQLKIRVMCASKREVARSLKRHKGIGW
DQSPLFKKIYEAEYGQFGGEPFGALIGDFHFDHSPPDVEMLGEMAKIAAAAHCPFIAGASPTVMQMDSWQ
ELSNPRDLTKIFQNTEHTAWRSLRESEDARYIGLAMPRFLARLPYGARTNPVDEFEFEEETDSAAHTRYT
WANSAYAMGVNINRSFKQYGWCTSIRGVESGGAVENLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFMPLVHRKNSDFAAFIGAQSLQQPAQYYDADATANANLAARLPYLFACCRFAHYLKCIVRDKIGSFRER
EDMERWLNDWIMNYVDGSPGTSSQDTKAMKPLAAAEVQVEAIEDNPGYYAAKFFLRPHYQLEGLTVSLRL
VSKLPSNKKDSS
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3119753-3121261 Variovorax paradoxus EPS chromosome, complete genome
ATGAGCACCGCACCGAAACAGACAGCGCGCGCACAGGCCACCACGGTCGAGGCACTGGCGCCGAACGAGT
TCTCCGACCTCCTGCAGCGCGAGTTCAAGCCCAAGACCGAGCAAGCGCGCGAGGCGGTGCAGAACGCCGT
CAAGACGCTCGCCGTGCAGGCGCTGGAGAGCACGGTCACCATCTCCAACGATGCCTATCGCACGGTCCAG
GGCATCATCACCGAGATCGACCGCAAGCTCACCGAGCAGATCAACCAGATCCTGCACCACGAGGACTTCC
AGCAGCTCGAGGGCGCATGGCGCGGCCTGCACTACCTGGTGAACAACACCGAGACCGACGAGCAACTCAA
GATCCGCGTGATGTGCGCCTCCAAGCGCGAAGTGGCGCGTTCGCTCAAGCGCCACAAGGGCATCGGCTGG
GACCAGAGCCCGCTCTTCAAGAAGATCTACGAAGCCGAATATGGCCAGTTCGGCGGCGAGCCCTTCGGCG
CGCTGATCGGCGACTTCCACTTCGACCACAGCCCGCCCGATGTCGAGATGCTCGGCGAAATGGCCAAGAT
CGCCGCGGCCGCGCACTGCCCCTTCATCGCGGGCGCGTCGCCCACGGTGATGCAGATGGACTCGTGGCAG
GAACTGTCGAACCCGCGCGACCTCACCAAGATCTTCCAGAACACCGAGCACACCGCATGGCGCTCGCTGC
GCGAATCGGAAGACGCACGCTACATCGGCCTGGCCATGCCGCGCTTCCTGGCGCGCCTGCCGTACGGCGC
GCGCACCAACCCGGTCGATGAATTCGAGTTCGAGGAAGAAACCGATTCGGCCGCGCACACCCGCTACACC
TGGGCCAACTCGGCCTATGCAATGGGCGTGAACATCAATCGCTCGTTCAAGCAGTACGGCTGGTGCACCT
CGATCCGCGGCGTGGAATCGGGCGGCGCGGTGGAGAACCTGCCCACCCACACCTTCCCCACCGACGACGG
CGGCGTGGACATGAAGTGCCCCACCGAGATCGCCATCAGCGACCGGCGAGAGGCCGAGCTTGCCAAGAAC
GGCTTCATGCCGCTGGTGCACCGCAAGAACTCTGACTTCGCGGCCTTCATCGGCGCGCAGTCGCTGCAGC
AGCCGGCCCAGTACTACGACGCCGACGCCACGGCCAACGCGAACCTCGCGGCGCGCCTGCCGTACCTGTT
CGCGTGCTGCCGCTTTGCGCACTACCTCAAGTGCATCGTGCGGGACAAGATCGGATCGTTTCGCGAGCGC
GAGGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGATGGCAGTCCAGGCACATCGTCGC
AGGACACGAAGGCAATGAAGCCGCTGGCGGCGGCGGAGGTCCAGGTGGAAGCCATCGAGGACAACCCCGG
CTACTACGCCGCCAAGTTTTTTCTCCGGCCGCACTATCAGCTCGAAGGGCTGACGGTTTCCTTGCGGCTG
GTTTCGAAGCTGCCGTCCAACAAGAAGGACAGCAGCTAA