SecReT6
Protein ID: 319793563
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2901
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3121307..3121789 [+]
Producthypothetical protein
NoteTssD
UniProt IDE6V5V1
KEGG IDvpe:Varpa_2901
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-35, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|319793563|ref|YP_004155203.1| hypothetical protein Varpa_2901 [Variovorax paradoxus EPS]
MAVDMFMRVEGANGESKDSNHKDWSDIKSFAWGATQPGNMVSGGGGGVGKASFNDLQVVARIDKAAPSIL
KNCASGKHLSKVEVSLCKAGGTQIEYTRVTLEEVLVTSVQYTAEQGGDAVLVQFAFQAAKVKQQYWEQTD
KGGKGAETVLGWNLKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3121307-3121789 Variovorax paradoxus EPS chromosome, complete genome
ATGGCAGTAGACATGTTCATGCGCGTTGAGGGCGCGAACGGCGAATCCAAGGACTCGAACCACAAGGATT
GGAGCGATATCAAGTCGTTCGCATGGGGTGCAACGCAGCCTGGCAACATGGTCAGCGGCGGCGGCGGCGG
TGTGGGCAAGGCCAGCTTCAACGACCTGCAGGTGGTCGCGCGCATCGACAAGGCGGCCCCGTCCATCCTG
AAGAACTGCGCGAGCGGCAAGCACCTGAGCAAGGTCGAGGTGTCGCTGTGCAAGGCCGGCGGCACGCAGA
TCGAATACACGCGCGTCACGCTCGAGGAAGTGCTGGTCACCTCGGTGCAGTACACGGCGGAGCAGGGCGG
CGACGCGGTGCTCGTGCAGTTCGCGTTCCAGGCCGCCAAGGTCAAGCAGCAGTATTGGGAGCAGACCGAC
AAGGGCGGCAAGGGCGCCGAGACGGTGCTCGGCTGGAACCTCAAGGAAAACAAGGAAGCCTGA