SecReT6
Protein ID: 319793565
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2903
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3122802..3123365 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE6V5V3
KEGG IDvpe:Varpa_2903
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-19, Aligned region: 57..163
Protein Sequence: 187 a.a.     [Download]
>gi|319793565|ref|YP_004155205.1| type VI secretion system lysozyme-like protein [Variovorax paradoxus EPS]
MSTTLPASRSAAIDADGDPQESVARDRLQPVLLDRLTDKQPQSRQERAGSFLMSGRLLRDSVLRDLQWLL
NTTNFGTEHGINAMPRARRSVVNYGVRGWAGGRMSEVDFADVEAAIRAAIIDFEPRIMKDSIDVRCVTDA
ADLEHHNLLALEIRGTLWSVPYPIEFILRSELDLESGHMILRPTGGL
 
Nucleotide Sequence: 564 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3122802-3123365 Variovorax paradoxus EPS chromosome, complete genome
GTGAGCACCACGCTGCCCGCCAGCCGTTCCGCGGCGATCGACGCCGATGGCGATCCGCAGGAAAGCGTTG
CGCGCGACCGCCTGCAGCCCGTGCTGCTCGATCGCCTGACCGACAAGCAGCCGCAGAGCCGCCAGGAGCG
CGCGGGCAGTTTTCTCATGAGCGGCAGGCTCTTGCGCGACTCGGTGCTGCGCGACCTGCAGTGGCTGCTC
AATACCACCAACTTCGGCACCGAGCACGGCATCAACGCCATGCCGCGCGCGCGGCGCTCGGTCGTGAACT
ACGGCGTGCGCGGCTGGGCCGGCGGGCGCATGTCGGAGGTCGACTTCGCCGACGTCGAGGCCGCCATCCG
CGCCGCGATCATCGACTTCGAGCCGCGCATCATGAAGGACAGCATCGACGTGCGCTGCGTGACCGATGCG
GCCGACCTCGAACACCACAACCTGCTCGCGCTGGAGATTCGCGGCACGCTGTGGTCGGTGCCTTATCCGA
TCGAATTCATCCTGCGCTCGGAGCTCGACCTCGAAAGCGGCCACATGATCCTGCGGCCGACGGGAGGCCT
CTGA