SecReT6
Protein ID: 319793566
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2904
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3123366..3125246 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDE6V5V4
KEGG IDvpe:Varpa_2904
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-213, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|319793566|ref|YP_004155206.1| type VI secretion protein [Variovorax paradoxus EPS]
MDARLLDYYNRELTYMHELGAEFAQRYPKIAGRLGMRGIEVSDPYVERLLEGFSFLTARIQLKMDAEFPR
FSQRLLEVVYPNFLAPLPAMAVVQIDGNLNEGSLKAGYELPRHTVLRGRMIKGEQTACEFRTGHPVTLWP
IRITEAGIGPVPAEIGHAMPMVARQAKSAITIKLEAVGGARFSEMPLDRLEFFLSGAELHALRVLELVAH
RSVGAVCRSGPGAQGGSSRIVPLGDEAIRHEGFDPDQALLPYDARSFQGYRLLHEYFAFPDRYLFFSVKN
LRAAVSAIGGSTMEIVILLDRADADLERLVDAKHFSLFCTPIINLVPRRSDRIPVGPGQHEHHAVIDRTR
PRDFEIFTVERVTGHMTNGSEEREFRPFLGSFATDDGDFGAYFSLRREPRLVSDRARAQGTRTSYTGSEV
YVSLVDQHDAPFPHSLRHITLDALCTNRDLPLLLPTGLESDFTLRISAPVRSIRILRGPSRPYPALAEGA
LTWRLISHLGLNYLSLTDVDAAQGAAALREMLDLYGNLADPAVRRQIQGVRSMALAPVFRRLPEPGPIVF
GRGVEVALKIDEVAFSGASPYLFGAVLEQFFSRHVSLNAFTEFALSSLQRGEIARWTPRVGRRPAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3123366-3125246 Variovorax paradoxus EPS chromosome, complete genome
ATGGACGCAAGGCTGCTCGACTACTACAACCGCGAACTCACCTACATGCACGAGCTCGGGGCCGAGTTCG
CGCAGCGCTACCCGAAGATCGCGGGCCGCCTGGGCATGCGCGGCATCGAGGTCAGCGATCCGTACGTGGA
GCGCCTGCTCGAGGGCTTCAGCTTTCTCACGGCGCGTATCCAGCTCAAGATGGATGCGGAGTTTCCGCGC
TTCTCGCAGCGCCTCCTGGAGGTGGTGTATCCCAACTTCCTCGCGCCGCTGCCCGCGATGGCGGTGGTGC
AGATCGACGGCAACCTCAACGAAGGCTCGCTGAAGGCGGGCTACGAACTGCCGCGCCACACCGTCCTGCG
CGGCCGCATGATCAAGGGCGAGCAGACGGCTTGCGAGTTCCGCACCGGCCACCCGGTCACGCTGTGGCCC
ATCAGGATCACCGAGGCCGGCATCGGCCCCGTGCCCGCGGAGATCGGGCATGCGATGCCGATGGTGGCGC
GCCAGGCCAAGAGCGCGATCACCATCAAGCTCGAAGCGGTGGGCGGCGCCAGGTTCTCCGAGATGCCGCT
CGACCGGCTCGAATTCTTTCTCTCGGGCGCCGAGTTGCATGCGCTGCGCGTGCTCGAACTGGTGGCGCAC
CGCAGCGTGGGGGCCGTGTGCCGCAGCGGCCCGGGCGCCCAAGGCGGGTCGTCGCGCATCGTGCCGCTGG
GCGACGAGGCCATCCGCCACGAAGGCTTCGACCCCGACCAGGCGCTGCTGCCCTACGACGCGCGCTCGTT
CCAGGGCTACCGGCTGCTGCACGAGTACTTCGCGTTTCCCGATCGCTACCTGTTCTTCAGCGTGAAGAAC
CTGCGCGCCGCGGTCTCGGCCATCGGCGGCAGCACGATGGAGATCGTGATCCTGCTGGACCGCGCCGACG
CCGACCTGGAGCGGCTGGTGGACGCCAAGCACTTCTCGCTCTTCTGTACGCCCATCATCAACCTCGTGCC
GCGCCGCAGCGACCGCATCCCGGTCGGGCCGGGCCAGCACGAGCACCACGCGGTGATCGACCGCACGCGC
CCGCGCGACTTCGAGATCTTCACCGTCGAGCGCGTCACCGGCCACATGACCAACGGCTCGGAGGAGCGCG
AGTTCCGCCCCTTCCTCGGCTCGTTCGCGACCGACGACGGCGACTTCGGCGCGTATTTCTCGCTGCGCCG
CGAACCGCGCCTGGTGTCGGACCGCGCACGCGCGCAGGGCACACGCACCAGCTACACCGGCAGCGAGGTC
TACGTGTCGCTGGTCGACCAGCACGACGCGCCGTTTCCGCACAGCCTGCGGCACATCACGCTCGATGCGC
TGTGTACCAACCGCGACCTGCCGCTGCTGCTTCCGACGGGGCTCGAGTCGGACTTCACGCTGCGCATCTC
GGCGCCCGTGCGCTCGATCCGCATCCTGCGCGGCCCGTCGCGGCCGTACCCGGCGCTGGCCGAAGGCGCG
CTCACCTGGCGGCTCATCAGCCACCTGGGCCTGAACTACCTGAGCCTGACCGACGTCGATGCCGCGCAGG
GCGCCGCCGCGCTGCGCGAGATGCTCGACCTCTACGGCAACCTCGCCGATCCCGCGGTGCGCCGCCAGAT
CCAGGGCGTGCGCTCGATGGCGCTCGCGCCGGTATTCCGCCGCTTGCCCGAGCCGGGGCCCATCGTCTTC
GGGCGCGGCGTGGAGGTGGCGCTCAAGATCGACGAGGTCGCGTTTTCCGGCGCGAGCCCGTATCTTTTCG
GCGCGGTGCTGGAGCAGTTCTTCAGCCGCCACGTGTCGCTCAATGCCTTTACCGAGTTCGCGCTCTCCAG
CCTGCAGCGCGGCGAAATCGCGCGCTGGACCCCACGGGTCGGACGCCGCCCCGCCGTATGA