SecReT6
Protein ID: 319793567
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2905
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3125243..3126439 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDE6V5V5
KEGG IDvpe:Varpa_2905
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-113, Aligned region: 59..360
Protein Sequence: 398 a.a.     [Download]
>gi|319793567|ref|YP_004155207.1| type VI secretion protein [Variovorax paradoxus EPS]
MSTAGFSDDMPQAAQVEGEELFEAHSFDEPAGQETPEIAATGRRDALLADPALWAGLVEQPFEHDLFMLL
RRLDAHGDHPLLGRAPRPSDEPLRLGQEPSMAFAPSNVSGVDADGDGPPRISIYGFGLFGPNGPLPLHLT
EYARERKRHHNDHTLSAFADLFHHRLILLFYRAWADAQSVNSLDRPDGHRFVDYVASLMNMGQPGLKERD
RIADHARTFMAGHLVRQTRNPEGLIQILRLYFDVPVRVEEFVSDWVMIDERQVSRLGLFGRNHQLGGGAT
IGLAVRDAQSKFRLELGPLSQQQFREFLPGSRRLQQVVDWVRQYVGIEFAWELRLVLRKQEARGMQLGSD
QRLGWGTWVGTRLSDTDAGDMLFEPEALYPRNTTAAAVPAESASSMAL
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3125243-3126439 Variovorax paradoxus EPS chromosome, complete genome
ATGAGTACAGCCGGCTTCTCCGACGACATGCCGCAGGCCGCGCAGGTGGAGGGCGAGGAGCTGTTCGAGG
CGCATTCGTTCGATGAACCCGCGGGCCAGGAGACGCCGGAAATTGCAGCGACGGGCCGCCGCGATGCGCT
GCTGGCCGACCCCGCACTGTGGGCCGGCCTGGTCGAGCAGCCCTTCGAGCACGACCTGTTCATGCTGCTG
CGCAGGCTCGATGCGCACGGCGACCATCCCCTGCTGGGCCGCGCACCCCGCCCATCGGATGAACCGCTGC
GCCTCGGGCAGGAGCCCTCGATGGCCTTCGCGCCGTCGAACGTCTCGGGTGTCGATGCCGATGGCGACGG
GCCGCCGCGCATCTCGATCTACGGCTTCGGCCTGTTCGGCCCCAACGGTCCGCTGCCGCTGCACCTGACC
GAGTACGCGCGCGAACGCAAGCGCCACCACAACGACCACACGCTCAGCGCATTCGCCGATCTGTTCCACC
ACCGGCTCATCCTGCTGTTCTACCGGGCCTGGGCCGATGCGCAATCGGTCAACAGCCTGGACCGCCCCGA
CGGCCACCGCTTCGTCGACTACGTGGCGAGCCTCATGAACATGGGGCAGCCGGGCCTGAAGGAGCGCGAC
CGCATTGCCGACCATGCGCGCACCTTCATGGCGGGCCATCTCGTGCGCCAGACGCGCAACCCCGAGGGGC
TGATCCAGATCCTGCGCCTGTACTTCGACGTGCCCGTGCGCGTCGAGGAATTCGTGAGCGACTGGGTGAT
GATCGACGAGCGCCAGGTGAGCCGGCTCGGGCTCTTCGGGCGCAACCACCAGCTCGGCGGCGGAGCCACC
ATCGGCCTGGCGGTGCGCGATGCGCAGAGCAAATTTCGCCTCGAACTCGGCCCGCTCTCGCAACAGCAGT
TTCGCGAATTCCTGCCGGGCAGCCGCCGGTTGCAGCAGGTGGTCGACTGGGTGCGGCAGTACGTCGGCAT
CGAGTTTGCCTGGGAGCTGCGGCTGGTGCTCAGGAAGCAGGAGGCGCGCGGCATGCAGCTGGGCAGCGAC
CAGCGCCTCGGCTGGGGCACGTGGGTCGGCACGCGCCTGTCGGACACCGACGCTGGAGACATGCTGTTCG
AGCCCGAGGCGCTGTATCCCCGCAACACAACGGCGGCCGCAGTGCCTGCCGAGTCCGCTTCTTCCATGGC
CCTATGA