SecReT6
Protein ID: 319793569
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2907
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3129208..3131541 [+]
Producttype VI secretion system vgr family protein
NoteTssI
UniProt IDE6V5V7
KEGG IDvpe:Varpa_2907
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-83, Aligned region: 24..328
Phage_base_V [PF04717], Evalue: 1.70E-20, Aligned region: 365..458
Protein Sequence: 777 a.a.     [Download]
>gi|319793569|ref|YP_004155209.1| type VI secretion system vgr family protein [Variovorax paradoxus EPS]
MARVVTAHTPLGEEQLKFRSMRGTEGLSQLFELEVDLLSPSAALDLKSVLGKPLSLEIRTAGARPRFLNG
QVVRFSMVGREGGTSRYTVYRASVRPWLWYLMRSSDNKIFQNKSVVEILEEVLGDYGFAFEKKLGGSYRT
WEYCVQYNESDFAFVSRLMELEGIYYWFRHEKGQHTLVLADDAGAHEPMPDYETIDYFAADRDIGEDLEV
IRDWQPGEEVRSGSYTVDDFNFTTPKGDLVNVRSQPRAHDNAGYEMYEWLGDYPAAGDGEHYARVRLEES
QALAQRSAGSSTVRGMAPGYTFRMRNSPRSDDNQEYLVVAVSYALREGGYASGAARGEYNFDFMVQPSAL
AFRAPRQTPVPRTSGPQTATVVGPEGEEIWTDEYGRVKVQFHWDRYGQKNENSSRFVRVSHIWAGERFGG
VFTPRIGQEVVVDFIGGRVDRPVIVGRVYNADQMPPFALPGEATKSGIVTRSSKGGSGANANAFVFEDKM
GAEQILLHAERNLDVEVEGDETHTTDKTRTTLIKGHESATYESGEERHITAGAVETIDGGEERTVTGGAT
ETVTGGEERTITGGATETIIGGETRTVTGGLIETVNGGVTLTVNGTVVRILSGTEIRIVGAGRIEIINAI
DTKVVNGTNVTTVTGPKIVFAPFIIHYADTYTINTVNYIVNAKVVIHNKPTQTLHIQEHSHWRWTRYDIE
VWQGGTHGMAFDIYGMKLMVSRWFLSANGIFVNLAAKTEIQTMNKYQVGWLKFRQFIDDRKTHGMRAVKG
TIFVKVN
 
Nucleotide Sequence: 2334 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3129208-3131541 Variovorax paradoxus EPS chromosome, complete genome
ATGGCGCGAGTCGTAACGGCGCATACGCCACTGGGTGAAGAGCAGCTGAAGTTCCGTTCGATGCGCGGCA
CGGAAGGGCTGTCGCAGCTGTTCGAGCTGGAGGTGGACCTGCTGAGTCCGAGCGCGGCGCTGGACCTGAA
GTCGGTGCTGGGCAAGCCGCTGTCGCTGGAGATCCGCACGGCGGGTGCGCGGCCGCGGTTCCTGAACGGG
CAGGTGGTGCGCTTCTCGATGGTGGGGCGCGAGGGCGGCACGTCGCGCTACACGGTGTACCGCGCGAGCG
TTCGGCCGTGGCTGTGGTACCTCATGCGCTCGAGCGACAACAAGATCTTCCAGAACAAGAGCGTGGTGGA
GATCCTGGAGGAGGTGCTGGGCGACTACGGCTTCGCGTTCGAGAAGAAGCTGGGCGGCAGCTATCGCACG
TGGGAGTACTGCGTGCAGTACAACGAGAGCGACTTCGCGTTCGTGAGCCGGCTGATGGAGCTGGAAGGCA
TCTACTACTGGTTCAGGCATGAGAAGGGCCAGCACACGCTGGTGCTGGCCGACGATGCGGGTGCGCACGA
GCCGATGCCGGACTACGAGACCATCGACTACTTCGCGGCCGACCGGGACATCGGCGAGGACCTGGAGGTC
ATCCGCGACTGGCAGCCCGGCGAGGAGGTGCGCTCGGGCAGCTACACGGTGGACGACTTCAACTTCACCA
CGCCCAAGGGCGACCTGGTGAACGTTCGCAGCCAACCGCGCGCGCACGACAACGCCGGCTACGAGATGTA
CGAGTGGCTGGGGGACTACCCGGCCGCGGGCGACGGCGAGCACTATGCGCGGGTGCGGCTGGAAGAGTCG
CAGGCGCTGGCGCAACGCAGCGCCGGATCTTCGACGGTGCGCGGCATGGCGCCGGGGTACACGTTCAGGA
TGCGCAACTCGCCGCGCTCGGACGACAACCAAGAGTACCTGGTGGTGGCGGTGTCGTATGCGCTGCGCGA
AGGCGGTTATGCGAGCGGGGCGGCCAGGGGCGAATACAACTTCGACTTCATGGTGCAGCCCAGCGCGCTG
GCGTTCAGGGCGCCGCGGCAAACGCCGGTGCCGCGCACGAGCGGGCCGCAGACGGCGACGGTGGTGGGGC
CCGAGGGCGAGGAGATCTGGACCGACGAGTACGGACGTGTGAAGGTGCAGTTCCACTGGGACCGCTACGG
CCAGAAGAACGAGAACAGCTCGCGCTTCGTGCGGGTGTCGCACATCTGGGCCGGGGAGCGCTTCGGGGGC
GTGTTCACGCCGCGCATCGGCCAGGAGGTGGTGGTGGACTTCATCGGCGGGCGAGTCGACCGGCCGGTGA
TCGTGGGGCGGGTGTACAACGCGGACCAGATGCCGCCGTTCGCGTTGCCGGGCGAGGCGACCAAGAGCGG
CATCGTGACGCGCTCGAGCAAGGGCGGCTCGGGCGCGAACGCGAACGCCTTCGTGTTCGAGGACAAGATG
GGCGCCGAGCAGATCCTGCTGCACGCCGAGCGCAACCTGGACGTGGAGGTGGAAGGCGACGAGACGCACA
CGACCGACAAGACGCGCACCACGCTGATCAAGGGGCACGAGTCGGCGACCTACGAGTCGGGGGAAGAGCG
GCACATCACCGCCGGGGCGGTGGAGACGATCGACGGGGGCGAGGAGCGCACGGTGACGGGCGGCGCGACC
GAGACGGTGACGGGCGGCGAGGAACGCACGATCACGGGCGGAGCGACCGAAACCATCATCGGCGGGGAGA
CGCGCACGGTCACCGGCGGCCTGATCGAGACAGTCAATGGCGGCGTGACACTGACAGTGAACGGCACCGT
GGTGCGGATCCTCAGTGGCACCGAAATCCGGATCGTCGGCGCAGGGCGTATCGAGATCATCAACGCGATC
GATACCAAGGTGGTGAATGGAACGAACGTCACCACCGTGACCGGCCCCAAGATCGTGTTCGCGCCATTCA
TCATCCACTACGCCGACACCTACACGATCAACACCGTCAACTACATCGTCAACGCCAAGGTGGTGATCCA
CAACAAGCCCACGCAGACGCTCCACATCCAGGAGCACAGCCACTGGCGTTGGACGCGCTACGACATCGAA
GTGTGGCAGGGCGGTACGCACGGCATGGCGTTCGACATCTACGGCATGAAGCTGATGGTGAGCAGGTGGT
TCCTGTCCGCCAATGGCATCTTCGTCAACCTCGCCGCGAAGACCGAGATCCAGACGATGAACAAGTACCA
GGTCGGCTGGTTGAAGTTCCGGCAGTTCATCGACGACCGAAAGACCCACGGAATGAGGGCGGTCAAGGGA
ACGATCTTTGTCAAGGTAAATTGA