SecReT6
Protein ID: 319793570
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2908
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3131556..3133886 [+]
Producttype VI secretion system vgr family protein
NoteTssI
UniProt IDE6V5V8
KEGG IDvpe:Varpa_2908
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-83, Aligned region: 24..328
Phage_GPD [PF05954], Evalue: 1.70E-83, Aligned region: 562..615
Phage_base_V [PF04717], Evalue: 1.70E-20, Aligned region: 365..458
Protein Sequence: 776 a.a.     [Download]
>gi|319793570|ref|YP_004155210.1| type VI secretion system vgr family protein [Variovorax paradoxus EPS]
MTRIVKAHTPLGEEQLKFRSMRGTEGLSQLFELEVDLLSPSAALDLKSVLGKPLSLEIRTAGARPRFLNG
QVVRFSMVGREGGTSRHTVYRASVRPWLWYLMRSSDNKIFQNKSVVEILEEVLGDYGFAFEKKLGGSYRT
WEYCVQYNESDFAFVSRLMELEGIYYWFRHEKGQHTLVLADDAGAHEPMPDYETIDYFAADRDIGEDLEV
IRDWQPGEEVRSGSYTVDDFNFTTPKGDLVNVRSQPRAHDNAGYEMYEWLGDYPAAGDGEHYARVRLEES
QALAQRSAGSSTVRGMAPGYTFRMRNSPRSDDNQEYLVVAVSYALREGGYASGAARGEYNFDFMVQPSAL
AFRAPRQTPVPRTSGPQTATVVGPEGEEIWTDEYGRVKVQFHWDRYGQKNENSSRFVRVSHIWAGERFGG
VFTPRIGQEVVVDFIGGRVDRPVIVGRVYNADQMPPFALPGEATKSGIVTRSSKGGSGANANAFVFEDKM
GAEQILLHAERNLDVEVEGDETHTTDKTRSTLIKGHESATYESGEERHITAGAVETIDGGEERTVTGGAT
ETVTGGEERTITGGATETITGGETRTVTGGLTETVNGGVTLTVNGNSIRLLSGSDLRITCSGRIETVNAM
DIKQVNGTDCTMVTGPKIVVAPLITYHTTQHIDTTSTYTIDATVSITRSPHTILNVSDETWLKCNFLRWS
NQTVRALVLATDFYGMKLQACAINTQINGWFTNRATTFLLDAPIKFETSARSSKKKGLNIGVCKLHLSCV
YMTKKK
 
Nucleotide Sequence: 2331 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3131556-3133886 Variovorax paradoxus EPS chromosome, complete genome
ATGACCAGGATCGTGAAGGCGCATACGCCACTGGGTGAAGAGCAGCTGAAGTTCCGTTCGATGCGCGGCA
CGGAAGGGCTGTCGCAGCTGTTCGAGCTGGAGGTGGACCTGCTGAGTCCGAGCGCGGCGCTGGACCTGAA
GTCGGTGCTGGGCAAGCCGCTGTCGCTGGAGATCCGCACGGCGGGTGCGCGGCCGCGGTTCCTGAACGGG
CAGGTGGTGCGCTTCTCGATGGTGGGGCGCGAGGGCGGCACGTCGCGCCACACGGTGTACCGCGCGAGCG
TTCGGCCGTGGCTGTGGTACCTCATGCGCTCGAGCGACAACAAGATCTTCCAGAACAAGAGCGTGGTGGA
GATCCTGGAGGAGGTGCTGGGCGACTACGGCTTCGCGTTCGAGAAGAAGCTGGGCGGCAGCTACCGCACG
TGGGAGTACTGCGTGCAGTACAACGAGAGCGACTTCGCGTTCGTGAGCCGGCTGATGGAGCTGGAAGGCA
TCTACTACTGGTTCAGGCATGAGAAGGGCCAGCACACGCTGGTGCTGGCCGACGATGCGGGTGCGCACGA
GCCGATGCCGGACTACGAGACCATCGACTACTTCGCGGCCGACCGTGACATCGGCGAGGACCTGGAGGTC
ATCCGCGACTGGCAGCCCGGCGAGGAGGTGCGCTCGGGCAGCTACACGGTGGACGACTTCAACTTCACCA
CGCCCAAGGGCGACCTGGTGAACGTTCGCAGCCAACCGCGCGCGCACGACAACGCCGGCTACGAGATGTA
CGAGTGGCTGGGGGACTACCCGGCCGCGGGCGACGGCGAGCACTATGCGCGGGTGCGGCTGGAAGAGTCG
CAGGCGCTGGCGCAACGCAGCGCCGGATCTTCGACGGTGCGCGGCATGGCGCCGGGGTACACGTTCAGGA
TGCGCAACTCGCCGCGCTCGGACGACAACCAAGAGTACCTGGTGGTGGCGGTGTCGTATGCGCTGCGCGA
AGGCGGTTATGCGAGCGGGGCGGCCAGGGGCGAATACAACTTCGACTTCATGGTGCAGCCCAGCGCGCTG
GCGTTCAGGGCGCCGCGGCAAACGCCGGTGCCGCGCACGAGCGGGCCGCAGACGGCGACGGTGGTGGGGC
CCGAGGGCGAGGAGATCTGGACCGACGAGTACGGACGTGTGAAGGTGCAGTTCCACTGGGACCGCTACGG
CCAGAAGAACGAGAACAGCTCGCGCTTCGTGCGGGTGTCGCACATCTGGGCCGGGGAGCGCTTCGGGGGC
GTGTTCACGCCGCGCATCGGCCAGGAGGTGGTGGTGGACTTCATCGGCGGGCGAGTCGACCGGCCGGTGA
TCGTGGGGCGGGTGTACAACGCGGACCAGATGCCGCCGTTCGCGTTGCCGGGCGAGGCGACCAAGAGCGG
CATCGTGACGCGCTCGAGCAAGGGCGGCTCGGGCGCGAACGCGAACGCCTTCGTGTTCGAGGACAAGATG
GGCGCCGAGCAGATCCTGCTGCACGCCGAGCGCAACCTGGACGTGGAGGTGGAAGGCGACGAGACGCACA
CGACCGACAAGACGCGCAGCACGCTGATCAAGGGGCACGAGTCGGCGACCTACGAGTCGGGGGAAGAGCG
GCACATCACCGCCGGGGCGGTGGAGACGATCGACGGGGGCGAGGAGCGCACGGTGACGGGCGGCGCGACC
GAGACGGTGACGGGCGGCGAGGAACGCACGATCACGGGCGGAGCGACCGAGACCATCACCGGCGGGGAGA
CGCGCACGGTCACCGGCGGCCTGACCGAGACGGTCAATGGCGGCGTGACACTGACGGTCAACGGCAACAG
CATCCGGCTGCTGAGCGGCTCGGATCTGCGCATCACCTGCAGCGGGCGCATCGAGACGGTCAATGCGATG
GACATCAAGCAGGTGAACGGGACCGACTGCACCATGGTCACCGGCCCGAAGATCGTGGTCGCGCCGCTGA
TCACCTATCACACGACGCAGCACATCGACACCACGAGCACCTACACGATCGACGCGACGGTGAGCATCAC
CAGATCGCCCCACACGATCCTCAACGTGTCCGACGAGACGTGGCTCAAGTGCAATTTCCTGCGGTGGTCC
AACCAGACCGTGCGGGCGCTCGTTCTCGCGACCGATTTCTATGGGATGAAGCTGCAGGCCTGCGCGATCA
ACACGCAGATCAACGGCTGGTTCACCAACAGGGCGACGACCTTCCTGCTCGACGCGCCGATCAAGTTCGA
GACCTCGGCGCGCAGTTCGAAGAAGAAGGGACTGAACATCGGCGTTTGCAAGCTGCACCTGTCGTGCGTC
TACATGACGAAGAAGAAATGA