SecReT6
Protein ID: 319793571
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2909
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3133942..3136284 [+]
Producttype VI secretion system vgr family protein
NoteTssI
UniProt IDE6V5V9
KEGG IDvpe:Varpa_2909
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-82, Aligned region: 25..329
Phage_base_V [PF04717], Evalue: 1.10E-22, Aligned region: 365..457
Protein Sequence: 780 a.a.     [Download]
>gi|319793571|ref|YP_004155211.1| type VI secretion system vgr family protein [Variovorax paradoxus EPS]
MDRIVKTHTPLGEDRLLLRSMQGIESLSRPYEFEVELLSTDVAIDPKSLLGKPLSLEIKTAVGAPRFLDG
QVVRFSKVGREGGTSRYTIYRAVLRPWLWYLSFSSGSRIFQNKSVVDILEDVFGAYGFAFEKKLSGSYRQ
WEYCAQYNESDLDFVSRLMELEGIYYWFRHEKGRHTLVLADDAGAHEPMPGYETIDYFAADRDIGEDLEV
IDDWQATEEVRTGSYAVGDFNFTTPKADLGGARSLPRAHDNAGYDAYEWLGEYVDAGQAEHYARVRLEEA
QSLASRSSGHATVRGMAPGAKFNMRNAPRGDDNREHLIVSVAYSLREGGYATGGAPGTYGFDFVAQPAED
QYRAPRQTPMPRTSGPQTATVVGPEGEEIWTDEYGRVKLQFHWDREGQRNENSSAWVRVSQAWAGEGYGT
VHVPRIGQEVVVDFIAGRVDRPIIVGRVYNADQMPPFDLPGEATQSGIVSRSTKGGSPANANAIVFEDKM
GAEQILLHAERNLDVEVEGDETHTTDKTRTTLIKGHELATYESGEERHITAGAVETIDGGEERTVTGGAT
ETVTGGEERTITGRATETITGGETRTVTGGLTETINGEVLVTINGSVLRLVSGADIRITGAGRVEVVNAI
DMTLVQGTKLTTVTGPKVIFAPTVLHLSGSNHTINVPGTLKINVTGVDVENTPVKTVNSVDAKWWLHAVK
EGIGHQALFVGASADSYATKIQLAVRNTLLQRSAFVNISAVNWVQAISRQELGHYHFWLDPILIAAGAVQ
YVKSALDVEK
 
Nucleotide Sequence: 2343 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3133942-3136284 Variovorax paradoxus EPS chromosome, complete genome
ATGGACCGCATCGTGAAGACCCACACTCCGCTGGGCGAAGACCGACTGCTGCTGCGCTCGATGCAAGGCA
TCGAGAGCCTTTCACGGCCCTACGAGTTCGAGGTCGAACTGCTCAGCACCGACGTGGCGATCGATCCGAA
GTCGCTGCTCGGAAAGCCGCTGTCGCTGGAGATCAAGACTGCAGTCGGAGCCCCGCGCTTCCTCGACGGT
CAGGTGGTGCGGTTCTCGAAGGTCGGGCGAGAAGGGGGCACTTCGCGCTACACGATCTACCGCGCCGTGC
TGCGCCCCTGGCTTTGGTACCTGTCGTTCTCCAGCGGCAGCAGGATCTTCCAGAACAAGTCGGTCGTGGA
CATCCTCGAGGACGTGTTCGGCGCCTACGGCTTCGCGTTCGAAAAGAAGCTGAGCGGCAGCTACCGGCAG
TGGGAGTACTGTGCGCAATACAACGAAAGCGACCTCGATTTCGTGAGCCGGCTGATGGAGCTGGAAGGCA
TCTACTACTGGTTCAGGCACGAGAAAGGCCGCCATACGCTGGTGCTGGCCGACGATGCGGGCGCGCACGA
GCCGATGCCGGGTTACGAGACCATCGACTACTTCGCGGCCGACCGCGACATCGGCGAGGACCTGGAGGTC
ATCGACGACTGGCAGGCGACCGAGGAGGTCCGCACGGGAAGCTACGCGGTCGGCGATTTCAACTTCACCA
CGCCCAAGGCCGACCTCGGCGGCGCGCGCAGCCTGCCGCGCGCGCACGACAACGCCGGCTACGACGCGTA
CGAGTGGCTCGGGGAATACGTCGACGCCGGACAGGCCGAGCACTATGCGCGCGTGCGGCTGGAAGAAGCG
CAGTCGCTGGCCTCGCGCAGCTCCGGCCATGCCACGGTGCGCGGCATGGCGCCGGGCGCCAAGTTCAACA
TGCGCAACGCGCCGCGCGGGGACGACAACCGCGAGCACCTGATCGTTTCGGTCGCCTACTCGCTGCGCGA
GGGCGGCTACGCCACGGGAGGCGCACCGGGCACGTACGGTTTCGATTTCGTCGCGCAGCCAGCGGAAGAT
CAGTATCGCGCACCGCGGCAGACCCCGATGCCACGCACGAGCGGGCCGCAGACCGCGACGGTGGTCGGTC
CCGAGGGCGAGGAGATCTGGACCGACGAGTACGGGCGGGTGAAGCTGCAGTTCCACTGGGACCGCGAAGG
CCAGCGCAACGAGAACAGCTCGGCCTGGGTGCGCGTCTCGCAGGCCTGGGCGGGCGAAGGCTACGGCACC
GTGCACGTGCCGCGCATCGGGCAGGAGGTGGTGGTCGATTTCATCGCGGGCCGTGTCGACCGTCCCATCA
TCGTCGGCCGTGTCTACAACGCGGACCAGATGCCGCCGTTCGATCTGCCGGGCGAGGCGACCCAGAGCGG
CATCGTCTCGCGCTCGACCAAGGGCGGCTCGCCCGCGAATGCGAACGCCATCGTGTTCGAGGACAAGATG
GGCGCCGAGCAGATCCTGCTGCACGCCGAGCGCAACCTGGACGTGGAGGTGGAAGGCGACGAGACGCACA
CGACCGACAAGACGCGCACCACGCTGATCAAGGGGCACGAGTTGGCGACCTACGAGTCGGGGGAAGAGCG
GCACATCACCGCCGGGGCGGTGGAGACGATCGACGGGGGCGAGGAGCGCACGGTGACGGGCGGCGCGACC
GAGACGGTGACGGGCGGCGAGGAACGCACGATCACGGGCAGAGCGACCGAGACCATCACCGGCGGGGAGA
CGCGCACGGTCACCGGCGGCCTGACCGAGACCATCAACGGCGAAGTGCTGGTGACGATCAATGGCAGCGT
GCTGCGCCTGGTCAGCGGGGCGGACATCCGCATCACCGGGGCAGGCCGGGTGGAAGTAGTGAACGCGATC
GACATGACGTTGGTGCAGGGAACCAAACTCACCACCGTGACCGGGCCGAAAGTGATCTTCGCGCCGACCG
TTCTTCATCTGTCCGGCAGCAACCATACGATCAATGTGCCAGGCACCCTCAAGATCAACGTGACCGGCGT
CGATGTCGAGAACACGCCGGTCAAGACGGTCAACTCGGTGGATGCCAAGTGGTGGCTCCATGCGGTCAAG
GAAGGCATCGGCCACCAGGCGCTGTTCGTGGGGGCCTCGGCCGACTCCTACGCGACCAAGATCCAGCTGG
CGGTGCGCAACACGCTGCTGCAGAGAAGTGCGTTCGTGAACATCTCGGCCGTCAACTGGGTGCAGGCCAT
CAGCAGGCAGGAGCTCGGCCACTACCATTTCTGGCTCGACCCCATATTGATCGCTGCCGGAGCGGTGCAG
TACGTCAAGAGTGCACTCGACGTCGAGAAATGA