SecReT6
Protein ID: 319793578
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2916
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3142537..3144570 [-]
Productfha domain containing protein
NoteFha
UniProt IDE6V5W6
KEGG IDvpe:Varpa_2916
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-10, Aligned region: 27..95
FHA [PF00498], Evalue: 1.50E-10, Aligned region: 366..385
Protein Sequence: 677 a.a.     [Download]
>gi|319793578|ref|YP_004155218.1| fha domain containing protein [Variovorax paradoxus EPS]
MRWTVIEHAGRPVTTGASALLAAPGGTIGRSPDNHLVLPDEQRQISRLQATVRFDQEGAVVLRNMSAVLP
ISVNGRTLQHEEESRIADGDRVVIGSYVLEAASAQRAANVPVRPPSPQPIDVPATLHPPAVQAMPASSLD
ALPQEAPVSDVFSDLFGAGALPIGDAPPTTVAMPAPASASVSAATPLPAPAPAPAFAPQPREQFAAPVVT
AAPAPAPAPAPSPFAKTTAPTTSQIPSAADWDAILANAPRRVDSAPTPMPDPLVHEPFELPSQARRNPVD
PLAELNPGAANDMSDVALKRGMDPLSFFAADSNAPSPLADPRPTALTHEDPLSDRHPALDLLGKPPAAQG
FNHSNHAREVGAQFRPPSPVAFDAPEVKPVHAEVSPLLEPLPPSPPPPPPPPPPQATSAPAPVAEPEAPA
AALPVTAAPAEVVPPVEVVSSEPVEAEEAPAPTALSPSPPAVAAALPPAASLSSPASSDELFKAFLEGAG
VPDVAGQQPLDAEAMRHLGRLMRAFTDGTIELLSSRAMLKREVRAEITMIVDEENNPFKILPNGRAVLMQ
MFGARMPGFLTPEAAVHDALGDLQSHQLGMVAGMRAALLTVLQRFDPATLSRTTPHDGSLGEKMLPGGRE
ARLWRQLRQLHAETAAAVEDDFQAVFGRAFQQAYDREMERLKEARRA
 
Nucleotide Sequence: 2034 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3144570-3142537 Variovorax paradoxus EPS chromosome, complete genome
ATGCGCTGGACCGTGATCGAACATGCCGGCAGGCCGGTGACAACAGGCGCCTCGGCGCTGCTTGCAGCAC
CCGGAGGCACCATCGGACGCAGCCCCGACAACCACCTCGTGCTGCCCGACGAGCAGCGGCAGATCTCGCG
CCTGCAGGCCACCGTGCGCTTCGACCAGGAGGGCGCTGTGGTGCTGCGCAACATGAGCGCGGTGCTGCCC
ATCAGCGTGAACGGCCGCACGCTGCAGCATGAGGAAGAGTCGCGCATTGCGGACGGGGACCGCGTGGTCA
TCGGGAGCTATGTGCTGGAGGCTGCGAGCGCCCAGCGTGCAGCAAACGTTCCCGTAAGGCCGCCTTCGCC
ACAGCCGATCGATGTGCCGGCGACGCTGCATCCGCCTGCGGTGCAGGCAATGCCGGCGAGTTCGTTGGAT
GCACTGCCGCAAGAGGCGCCCGTGTCCGACGTGTTCTCGGACCTGTTCGGCGCGGGCGCGCTGCCCATCG
GTGACGCGCCGCCGACGACCGTGGCGATGCCTGCGCCCGCATCTGCTTCCGTCTCTGCAGCGACTCCCCT
GCCCGCGCCGGCGCCGGCGCCGGCCTTTGCACCACAGCCCCGGGAACAGTTCGCAGCGCCTGTGGTCACG
GCTGCACCAGCACCAGCACCAGCACCAGCACCATCGCCGTTCGCGAAGACGACTGCGCCCACCACATCGC
AGATTCCATCCGCCGCCGATTGGGACGCCATCCTCGCGAACGCGCCTCGCCGCGTCGACAGCGCGCCGAC
GCCGATGCCCGACCCCTTGGTGCACGAGCCTTTCGAGCTGCCATCGCAGGCGCGAAGAAACCCCGTCGAT
CCGCTCGCTGAACTGAACCCGGGTGCAGCGAACGACATGTCCGACGTCGCGCTCAAGCGCGGCATGGACC
CGCTCTCGTTCTTTGCGGCCGACAGCAACGCACCCTCGCCGCTCGCCGATCCGCGCCCCACGGCACTCAC
CCATGAAGACCCGCTCAGCGACAGGCACCCGGCCCTCGACCTGCTGGGCAAGCCGCCTGCTGCGCAGGGG
TTCAACCACTCGAACCATGCGCGCGAAGTGGGGGCGCAATTCAGGCCGCCGAGTCCGGTGGCATTCGATG
CGCCCGAGGTGAAGCCGGTGCACGCGGAGGTGAGCCCGTTACTTGAACCACTACCGCCGTCGCCACCTCC
TCCTCCGCCGCCTCCTCCTCCTCAAGCAACATCGGCACCCGCGCCGGTTGCGGAGCCGGAAGCTCCCGCC
GCCGCGCTACCGGTCACCGCCGCACCCGCGGAGGTCGTTCCGCCAGTCGAGGTCGTGTCATCGGAACCGG
TCGAAGCCGAAGAGGCCCCGGCACCCACTGCGCTTTCGCCTTCGCCTCCCGCCGTGGCCGCGGCGCTCCC
GCCCGCAGCGTCGTTGTCATCGCCCGCGTCTTCCGACGAACTCTTCAAGGCCTTTCTCGAAGGCGCCGGC
GTGCCCGATGTCGCCGGCCAGCAGCCACTCGATGCGGAAGCCATGCGCCACCTCGGCCGGCTGATGCGCG
CGTTCACCGACGGCACCATCGAGCTCTTGTCGTCGCGCGCGATGCTCAAGCGCGAGGTACGCGCCGAGAT
CACGATGATCGTGGACGAAGAGAACAACCCCTTCAAGATCCTGCCCAACGGCCGCGCCGTGCTGATGCAG
ATGTTCGGCGCGCGCATGCCCGGTTTTCTCACGCCCGAAGCCGCAGTGCACGATGCGCTCGGCGACCTGC
AATCGCACCAGTTGGGCATGGTGGCCGGCATGCGCGCGGCGCTGCTCACCGTGCTGCAGCGCTTCGACCC
CGCGACGCTGAGCCGCACCACACCGCACGACGGCAGCCTCGGCGAAAAGATGCTGCCCGGCGGGCGCGAG
GCGCGCCTGTGGCGCCAGCTGCGGCAACTGCATGCGGAAACGGCCGCGGCCGTCGAAGACGACTTCCAGG
CCGTCTTCGGCCGCGCTTTCCAGCAGGCCTACGACCGGGAGATGGAACGCCTGAAGGAAGCGCGCCGTGC
TTGA