SecReT6
Protein ID: 319793580
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2918
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3145163..3145681 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE6V5W8
KEGG IDvpe:Varpa_2918
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-32, Aligned region: 20..164
Protein Sequence: 172 a.a.     [Download]
>gi|319793580|ref|YP_004155220.1| type VI secretion lipoprotein [Variovorax paradoxus EPS]
MQRRTLLQGALATTPLFAGLVSGCASTAKSLPTPYAVTIRIDDGVNPDGRGQAAPILVKVFELKSSGNFE
TADYFALQDRDRETLSTELVNADQAIMRSGEERVFKREAGLDSRSIGIIAGYRKLEAARWRIVLPLKEPK
QTNLYKVWQFSPSEQAVRIAIRKTGIELLPSR
 
Nucleotide Sequence: 519 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3145163-3145681 Variovorax paradoxus EPS chromosome, complete genome
ATGCAGCGACGAACCTTGCTTCAAGGCGCACTTGCAACCACACCGTTGTTTGCGGGCCTCGTCAGTGGAT
GCGCATCGACCGCCAAGTCGTTGCCCACGCCCTATGCGGTCACCATCCGCATCGACGACGGCGTGAACCC
CGACGGACGCGGCCAGGCAGCGCCGATTCTCGTGAAGGTCTTCGAACTGAAATCTTCCGGTAACTTCGAG
ACCGCAGACTATTTCGCGCTCCAGGACCGCGACCGCGAGACGCTTTCGACAGAGCTCGTCAATGCGGACC
AGGCCATCATGCGAAGCGGCGAAGAGCGTGTCTTCAAGCGAGAAGCAGGGCTCGACTCGCGCTCCATCGG
CATCATCGCGGGCTACCGCAAGCTCGAAGCTGCGCGGTGGCGCATCGTGTTGCCGCTCAAGGAGCCCAAG
CAAACCAATCTGTACAAGGTCTGGCAGTTTTCGCCAAGCGAACAAGCCGTGCGCATTGCCATCCGCAAGA
CAGGCATCGAGTTACTACCAAGTCGTTAA