SecReT6
Protein ID: 319793581
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2919
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3145844..3147220 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDE6V5W9
KEGG IDvpe:Varpa_2919
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-145, Aligned region: 34..457
Protein Sequence: 458 a.a.     [Download]
>gi|319793581|ref|YP_004155221.1| type VI secretion protein [Variovorax paradoxus EPS]
MTVRNSGSARSGAHPQALANRVVWSEGMYLRPQHFQQLERYVEQYVTRRAAGLQGAYWGWLHLDIDRDAY
ALGRVSLLGGAGVLPDGTPFSFGIEDAPPPYEVPNDLTDELIVLALPLRRPGSEEVIFAEDEGSAARFGV
IEREVADGNAVALGPAVLQLAAPRLRLARASSLTAEWQAIGAVRVIERRTDHKLVVDANYIPPVLDASAH
AMLRSMIAELHGLLTQRSEALASRLSQPGRGGVSEVSDFLLLELVNRYLATTWHAQQAVQVHPEQLFIDW
LKLACHLATHTSPTRRPVLWPVYDHDNLNESIRPLMEELRRSLSAVLEQSAIAIELEERSHGVRVGHMPD
PVLVRNAGFVLAVHADLPAEAIQQRFPTQVKIGSVERIRDLVQLQLPGVTVRPLPVAPRQIPYNAGYHYF
ELDKSGDMWRQLEKSGGVAMHLAGDFPGLAMEFWAIRP
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3145844-3147220 Variovorax paradoxus EPS chromosome, complete genome
GTGACAGTTCGCAACTCGGGCTCCGCAAGATCGGGCGCCCATCCGCAGGCATTGGCGAACCGCGTGGTGT
GGTCCGAAGGCATGTACCTGCGGCCCCAGCATTTCCAGCAACTGGAGCGTTACGTCGAGCAGTACGTCAC
GCGTCGCGCCGCCGGCCTGCAGGGCGCGTACTGGGGGTGGCTGCATCTGGACATCGACCGCGACGCCTAT
GCGCTCGGGCGCGTGTCGCTGCTCGGTGGCGCCGGCGTGCTGCCCGATGGAACGCCGTTTTCTTTCGGCA
TCGAAGACGCGCCGCCGCCCTACGAAGTGCCCAACGATCTGACCGATGAACTCATCGTGCTCGCACTGCC
GCTGCGCAGACCCGGCAGCGAAGAGGTCATCTTTGCCGAGGACGAGGGCTCTGCCGCGCGCTTCGGCGTG
ATCGAGCGCGAGGTGGCCGACGGCAACGCGGTGGCCCTCGGCCCGGCAGTGCTGCAGCTCGCGGCGCCGC
GCCTGCGCCTTGCACGCGCCTCGTCGCTCACCGCGGAGTGGCAGGCCATCGGTGCGGTGCGCGTGATCGA
GCGGCGCACCGACCACAAGCTGGTGGTCGATGCCAACTACATCCCTCCGGTGCTCGATGCATCGGCCCAC
GCGATGCTGCGCAGCATGATCGCGGAGCTGCACGGCCTGCTCACGCAACGCTCCGAGGCGCTGGCTTCGC
GGCTCTCGCAGCCGGGCCGCGGTGGTGTGAGCGAGGTCTCCGATTTCCTCCTGCTCGAGCTGGTCAACCG
CTACCTCGCGACCACCTGGCACGCGCAGCAGGCGGTGCAGGTGCACCCCGAGCAGTTGTTCATCGACTGG
CTCAAGCTGGCCTGCCACCTTGCCACGCACACCTCGCCCACGCGCCGTCCGGTGCTGTGGCCGGTGTACG
ACCACGACAACCTCAACGAGAGCATCCGTCCGCTGATGGAAGAGCTGCGCCGATCGCTGTCGGCCGTGCT
CGAGCAGAGCGCGATCGCCATCGAACTGGAGGAGCGCAGCCATGGCGTGCGCGTGGGCCACATGCCCGAC
CCGGTGCTGGTGCGCAACGCGGGCTTCGTGCTCGCGGTGCATGCGGACCTGCCGGCCGAGGCGATCCAGC
AGCGCTTTCCCACGCAGGTCAAGATCGGTTCGGTCGAGCGCATCCGCGATCTCGTACAGCTGCAGCTGCC
GGGCGTCACGGTGCGACCGCTGCCGGTGGCGCCGCGGCAGATTCCCTACAACGCGGGCTATCACTACTTC
GAGCTCGACAAGAGCGGCGACATGTGGCGCCAGCTCGAGAAATCCGGCGGCGTCGCCATGCACCTGGCCG
GTGACTTTCCGGGCCTGGCCATGGAGTTCTGGGCCATCCGTCCGTGA