SecReT6
Protein ID: 319793582
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2920
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3147229..3148599 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDE6V5X0
KEGG IDvpe:Varpa_2920
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-73, Aligned region: 70..274
DUF2077 [PF09850], Evalue: 1.60E-73, Aligned region: 402..438
OmpA [PF00691], Evalue: 1.70E-15, Aligned region: 83..99
OmpA [PF00691], Evalue: 1.70E-15, Aligned region: 337..435
RskA [PF10099], Evalue: 0.00015, Aligned region: 213..346
Protein Sequence: 456 a.a.     [Download]
>gi|319793582|ref|YP_004155222.1| DotU family type IV/VI secretion system protein [Variovorax paradoxus EPS]
MNGVNDMAVGPGGFVPPNPGGGNGGGNGGNGDAGGMPASPRGLGQQPESFTAWHDARRPHAGDAALAGNN
PLVAAANPLLDLIPQIRATGHHDAPAQLRENLVDEVRRFETRAQQSGISPEVIIGARYCLCTAVDEAAAL
TPWGGSIWSSQSLLVMFHNETWGGEKFFQLLSRLVQNPQQHLHLIELIYFCLAMGFEGRFRVIDNGRTQL
ETLKQRLLQIIRQTRGEIAQPLSPHWQDATAPVRRTRNWLPVWAVGAVAAVLLVLTFAVLTFNLAGNSDG
AFAAVNAVRLPQTARAVVMPAPQPRLQRFLEPEIREGLLTVRDEADRSVVVLRGDGLFASGSDRVLDRYV
PVLSRVADALNSVEGNVLVSGFSDDQPIRSVRFPSNWQLSQARADSVKKMLAVRITRPERLRAEGRGDAD
PLAPNDSPANRARNRRVEVTLLVAPVTPSAQQGGTR
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3147229-3148599 Variovorax paradoxus EPS chromosome, complete genome
ATGAACGGTGTCAACGACATGGCCGTCGGTCCGGGGGGCTTCGTGCCGCCGAACCCCGGCGGCGGTAACG
GCGGCGGCAATGGCGGCAACGGCGATGCGGGCGGCATGCCGGCATCGCCGCGCGGGCTGGGCCAGCAACC
CGAATCCTTCACCGCATGGCACGACGCACGGCGCCCGCATGCGGGCGATGCCGCGCTCGCAGGCAACAAC
CCGCTGGTGGCGGCCGCCAACCCGCTGCTCGACCTGATCCCGCAGATCCGCGCGACGGGCCACCACGATG
CGCCGGCGCAATTGCGCGAGAACCTCGTGGACGAAGTGCGCCGCTTCGAGACCCGCGCGCAGCAAAGCGG
CATCTCGCCCGAGGTGATCATCGGCGCGCGCTACTGCCTCTGCACTGCGGTGGACGAGGCCGCTGCGCTC
ACGCCGTGGGGTGGCAGCATCTGGTCGTCGCAGAGCCTGCTGGTGATGTTTCACAACGAGACCTGGGGCG
GCGAGAAATTCTTCCAGCTGCTTTCGCGCCTGGTGCAGAACCCGCAGCAGCACCTGCACCTGATCGAACT
CATCTACTTCTGCCTGGCCATGGGCTTCGAAGGGCGCTTTCGCGTCATCGACAACGGCCGCACGCAGCTC
GAAACCCTGAAGCAGCGCCTGCTGCAGATCATTCGCCAGACGCGCGGCGAAATCGCGCAGCCGCTGTCGC
CGCACTGGCAGGACGCGACCGCGCCGGTGCGCCGCACACGCAACTGGCTGCCGGTGTGGGCGGTGGGCGC
CGTGGCGGCGGTGCTGCTGGTGCTCACCTTCGCAGTGCTCACTTTCAACCTCGCGGGCAACTCCGATGGT
GCGTTCGCGGCCGTCAATGCGGTGCGGCTGCCGCAGACGGCGCGCGCGGTCGTCATGCCCGCGCCGCAGC
CGCGCCTGCAGCGCTTTCTCGAACCCGAGATCCGCGAAGGCCTGCTGACGGTGCGCGACGAGGCCGACCG
CAGCGTGGTGGTGCTGCGCGGCGACGGGCTCTTCGCCTCCGGCTCCGACCGCGTGCTCGACCGCTATGTG
CCGGTGCTCAGCCGCGTGGCCGATGCGCTCAATTCCGTGGAGGGCAACGTGCTGGTCAGCGGCTTCAGCG
ACGACCAGCCGATCCGCAGCGTGCGCTTTCCTTCCAACTGGCAGCTCTCGCAGGCACGCGCCGATTCGGT
CAAGAAGATGCTGGCCGTGCGCATCACGCGGCCTGAACGCCTGCGTGCCGAAGGCCGCGGCGATGCCGAT
CCGCTCGCGCCCAACGATTCGCCGGCCAACCGCGCGCGCAACCGCCGCGTCGAGGTCACGCTGCTGGTCG
CGCCCGTGACGCCGTCGGCGCAGCAAGGGGGAACCCGCTGA