SecReT6
Protein ID: 319793920
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3263
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3511796..3514117 [-]
ProductATP-dependent clp protease, ATP-binding subunit clpa
NoteTssH
UniProt IDE6VB00
KEGG IDvpe:Varpa_3263
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.30E-50, Aligned region: 216..295
AAA_2 [PF07724], Evalue: 5.30E-50, Aligned region: 429..453
AAA_2 [PF07724], Evalue: 5.30E-50, Aligned region: 494..655
AAA [PF00004], Evalue: 8.30E-27, Aligned region: 219..350
AAA [PF00004], Evalue: 8.30E-27, Aligned region: 500..623
ClpB_D2-small [PF10431], Evalue: 4.20E-22, Aligned region: 661..741
AAA_5 [PF07728], Evalue: 6.70E-18, Aligned region: 219..296
AAA_5 [PF07728], Evalue: 6.70E-18, Aligned region: 499..617
Clp_N [PF02861], Evalue: 1.50E-15, Aligned region: 13..62
Clp_N [PF02861], Evalue: 1.50E-15, Aligned region: 109..131
AAA_16 [PF13191], Evalue: 6.10E-11, Aligned region: 196..240
AAA_16 [PF13191], Evalue: 6.10E-11, Aligned region: 261..300
AAA_16 [PF13191], Evalue: 6.10E-11, Aligned region: 469..516
AAA_16 [PF13191], Evalue: 6.10E-11, Aligned region: 561..590
AAA_16 [PF13191], Evalue: 6.10E-11, Aligned region: 690..745
Sigma54_activat [PF00158], Evalue: 2.00E-10, Aligned region: 213..298
Sigma54_activat [PF00158], Evalue: 2.00E-10, Aligned region: 498..620
AAA_22 [PF13401], Evalue: 7.10E-09, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 7.10E-09, Aligned region: 497..601
AAA_17 [PF13207], Evalue: 4.30E-07, Aligned region: 220..278
AAA_17 [PF13207], Evalue: 4.30E-07, Aligned region: 500..534
Zeta_toxin [PF06414], Evalue: 7.40E-07, Aligned region: 219..243
Zeta_toxin [PF06414], Evalue: 7.40E-07, Aligned region: 351..442
Zeta_toxin [PF06414], Evalue: 7.40E-07, Aligned region: 499..595
RuvB_N [PF05496], Evalue: 9.30E-07, Aligned region: 273..298
RuvB_N [PF05496], Evalue: 9.30E-07, Aligned region: 466..590
Mg_chelatase [PF01078], Evalue: 1.60E-06, Aligned region: 216..258
Mg_chelatase [PF01078], Evalue: 1.60E-06, Aligned region: 498..538
Mg_chelatase [PF01078], Evalue: 1.60E-06, Aligned region: 560..617
AAA_18 [PF13238], Evalue: 5.00E-05, Aligned region: 220..255
AAA_18 [PF13238], Evalue: 5.00E-05, Aligned region: 501..530
AAA_3 [PF07726], Evalue: 7.60E-05, Aligned region: 219..239
AAA_3 [PF07726], Evalue: 7.60E-05, Aligned region: 500..616
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 213..276
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 499..517
TIP49 [PF06068], Evalue: 0.00038, Aligned region: 218..259
TIP49 [PF06068], Evalue: 0.00038, Aligned region: 288..298
TIP49 [PF06068], Evalue: 0.00038, Aligned region: 462..521
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 220..241
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 500..519
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 602..614
AAA_25 [PF13481], Evalue: 0.0023, Aligned region: 219..243
AAA_25 [PF13481], Evalue: 0.0023, Aligned region: 408..445
AAA_25 [PF13481], Evalue: 0.0023, Aligned region: 499..518
NACHT [PF05729], Evalue: 0.0024, Aligned region: 219..246
NACHT [PF05729], Evalue: 0.0024, Aligned region: 501..518
DEAD [PF00270], Evalue: 0.003, Aligned region: 89..123
DEAD [PF00270], Evalue: 0.003, Aligned region: 207..383
DEAD [PF00270], Evalue: 0.003, Aligned region: 497..515
Arch_ATPase [PF01637], Evalue: 0.0066, Aligned region: 37..69
Arch_ATPase [PF01637], Evalue: 0.0066, Aligned region: 114..165
Arch_ATPase [PF01637], Evalue: 0.0066, Aligned region: 197..233
Arch_ATPase [PF01637], Evalue: 0.0066, Aligned region: 268..306
Arch_ATPase [PF01637], Evalue: 0.0066, Aligned region: 503..515
ResIII [PF04851], Evalue: 0.0081, Aligned region: 203..241
ResIII [PF04851], Evalue: 0.0081, Aligned region: 285..299
ResIII [PF04851], Evalue: 0.0081, Aligned region: 498..515
AAA_33 [PF13671], Evalue: 0.0088, Aligned region: 219..236
AAA_33 [PF13671], Evalue: 0.0088, Aligned region: 375..413
AAA_33 [PF13671], Evalue: 0.0088, Aligned region: 500..529
AAA_33 [PF13671], Evalue: 0.0088, Aligned region: 706..726
Protein Sequence: 773 a.a.     [Download]
>gi|319793920|ref|YP_004155560.1| ATP-dependent clp protease, ATP-binding subunit clpa [Variovorax paradoxus EPS]
MIAQELEVSLHMAFVEARQQRHEFITVEHLLLALLDNPSAAEVLRACSANVDDLRASLTNFIKDNTPQVA
GTDDVDTQPTLGFQRVIQRAIMHVQSTGNGKKEVTGANVLVAIFGEKDSHAVYYLHQQGVTRLDVVNFIA
HGIKKSDPPEAVKGSGEAPQGEGEEGGGERNEKASPLEQFTQNLNQLAKDGKIDPLIGREYEVERVIQIL
CRRRKNNPLLVGEAGVGKTAIAEGLAWRITQGDVPEILAEAQVYSLDMGALLAGTKYRGDFEQRLKGVLK
SLKDKPNAVLFIDEIHTLIGAGAASGGTLDASNLLKPALSSGQLKCIGATTFTEYRGIFEKDAALSRRFQ
KVDVVEPSVQETVDILKGLKSRFEEHHGVKYAVAALQAAAELSAKYINDRHLPDKAIDVIDEAGAAQRIL
PPSKRKKTISKTEVEEIVAKIARIPPANVSNDDRSKLQTIERDLKSVVFGQDKALEVLASAVKMARSGLG
KGDKPIGSFLFSGPTGVGKTEAAKQLAYIMGIELIRFDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEA
VTKKPHSVLLLDEIEKAHPDIFNVLLQVMDHGTLTDNNGRKADFRNVIIIMTTNAGAETMNKATIGFTNP
RQAGDEMGDIKRLFSPEFRNRLDAIVNFKALDENIILRVVDKFLLQLETQLAEKKVEVTFSDKLRKHLAK
KGFDPLMGARPMQRLIQDTIRRALADELLFGRLTDGGRLEVDLDDKDEVLLDIQPLPKKEGKSKPEAEEA
ATG
 
Nucleotide Sequence: 2322 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3514117-3511796 Variovorax paradoxus EPS chromosome, complete genome
ATGATTGCCCAGGAACTGGAAGTCAGCTTGCACATGGCCTTCGTCGAGGCCCGGCAGCAGCGCCACGAGT
TCATCACCGTGGAGCATCTGCTGCTCGCTTTGCTGGACAACCCGAGCGCCGCAGAGGTTCTGCGCGCCTG
CTCGGCGAACGTCGACGACCTTCGGGCGTCGCTCACCAACTTCATCAAGGACAACACGCCGCAAGTGGCG
GGTACCGACGATGTAGACACCCAGCCCACGCTGGGTTTCCAGCGCGTGATCCAGCGCGCCATCATGCATG
TGCAGTCCACCGGCAACGGCAAGAAGGAAGTCACCGGCGCCAACGTGCTGGTCGCGATCTTCGGTGAGAA
GGACTCGCATGCCGTCTACTACCTGCACCAGCAGGGCGTGACCCGCCTCGACGTGGTGAACTTCATTGCC
CACGGCATCAAGAAGAGCGATCCGCCGGAAGCCGTCAAGGGCAGCGGCGAAGCCCCCCAGGGCGAAGGCG
AAGAGGGCGGCGGCGAACGCAACGAGAAGGCATCGCCGCTCGAGCAGTTCACCCAAAACCTCAACCAGCT
CGCCAAGGACGGCAAGATCGATCCGCTGATCGGCCGCGAATACGAGGTCGAGCGCGTCATCCAGATCCTG
TGCCGCCGGCGCAAGAACAACCCGCTGCTCGTGGGCGAGGCCGGTGTCGGCAAGACCGCGATTGCGGAAG
GCCTGGCATGGCGCATCACCCAGGGTGACGTGCCCGAGATCCTTGCCGAGGCGCAGGTCTACTCGCTCGA
CATGGGCGCATTGCTGGCCGGCACCAAGTACCGCGGCGATTTCGAGCAGCGCCTGAAGGGTGTGCTCAAG
TCGCTGAAGGACAAGCCGAACGCCGTGCTCTTCATCGACGAAATCCACACGCTGATCGGTGCGGGCGCTG
CCTCGGGCGGCACGCTCGATGCATCGAACCTGCTGAAGCCGGCGCTCTCGAGCGGCCAGCTCAAGTGCAT
CGGTGCGACCACGTTCACCGAATACCGCGGCATCTTCGAGAAGGATGCGGCCCTGTCGCGCCGTTTCCAG
AAGGTCGACGTGGTCGAGCCGTCGGTGCAGGAAACCGTCGACATCCTCAAGGGCCTGAAGTCGCGCTTCG
AGGAACACCATGGCGTGAAGTACGCGGTGGCGGCCCTGCAGGCTGCGGCCGAGCTCAGCGCCAAGTACAT
CAATGACCGTCACCTGCCCGACAAGGCGATCGACGTCATCGACGAAGCCGGCGCCGCCCAGCGCATCCTG
CCGCCGAGCAAGCGCAAGAAGACCATCAGCAAGACCGAGGTCGAGGAAATCGTCGCGAAGATCGCGCGCA
TTCCCCCGGCCAACGTCAGCAACGACGACCGCAGCAAGCTGCAGACGATCGAGCGCGACCTGAAGAGCGT
GGTGTTCGGCCAGGACAAGGCACTCGAAGTGCTTGCCTCCGCGGTCAAGATGGCGCGTTCGGGCCTGGGC
AAGGGCGACAAGCCGATCGGCTCGTTCCTGTTCTCCGGTCCCACGGGCGTCGGCAAGACCGAAGCGGCCA
AGCAGCTTGCCTACATCATGGGCATCGAGCTGATCCGCTTCGACATGTCGGAGTACATGGAGCGTCACGC
GGTGAGCCGCCTGATCGGCGCGCCTCCGGGCTACGTCGGTTTCGACCAAGGCGGTCTGTTGACCGAGGCT
GTCACGAAGAAGCCGCATTCGGTGCTGCTGCTCGACGAAATCGAGAAGGCGCATCCGGACATCTTCAACG
TGCTGCTGCAGGTGATGGACCATGGCACGCTGACGGACAACAACGGACGCAAGGCCGACTTCCGCAACGT
CATCATCATCATGACGACGAATGCGGGTGCCGAGACCATGAACAAGGCGACCATCGGCTTCACCAACCCG
CGTCAGGCGGGCGACGAAATGGGCGACATCAAGCGCCTGTTCTCGCCCGAGTTCCGCAACCGGCTGGACG
CCATCGTCAACTTCAAGGCGCTGGACGAGAACATCATCCTGCGCGTGGTCGACAAGTTCCTGCTGCAGCT
CGAAACGCAACTGGCCGAGAAGAAGGTGGAAGTCACCTTCAGCGACAAGCTGCGCAAGCACCTGGCGAAG
AAGGGCTTCGATCCGCTGATGGGCGCGCGTCCGATGCAGCGTCTGATCCAGGACACGATCCGTCGTGCAC
TGGCCGACGAGCTGCTGTTCGGTCGCCTGACCGACGGTGGTCGCCTCGAAGTCGACCTCGACGACAAGGA
CGAAGTGCTGCTGGACATCCAGCCGCTGCCGAAGAAGGAAGGCAAGTCCAAGCCTGAAGCCGAAGAGGCC
GCCACGGGCTGA