SecReT6
Protein ID: 319793922
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3266
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3515293..3516279 [-]
Productimpa domain-containing protein
NoteTssA
UniProt IDE6VB02
KEGG IDvpe:Varpa_3266
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.60E-19, Aligned region: 59..118
Protein Sequence: 328 a.a.     [Download]
>gi|319793922|ref|YP_004155562.1| impa domain-containing protein [Variovorax paradoxus EPS]
MTYVDSPLVPAVELQPLNASDPCGPSLEYDAEYAVLLSRMSPRGDAQYGQFVGTPEAPNWAEIERDCRRL
LLRTRDINLFVWLCRARTRVAQAAGLAQSLAVLSEVLERWPDAVHPQLVVEGERDPAVRANALAALADPD
GLLGDVREIVVAANAARHLTVREIERARSVPRLVDAPSPESVAQQLAQLRLAANGDADAPVNLLSEALRA
TRQIAEWAVRQLGGDAPSLQALIDLLKPFDEIDVVRRTEPVSPREGVLRPSVSGLASRDDALQAIRSARQ
WFENHEPSSPVAVLLKQAERMVGQRFALVANAIPLDLLQKWDSEGERV
 
Nucleotide Sequence: 987 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3516279-3515293 Variovorax paradoxus EPS chromosome, complete genome
ATGACCTACGTTGACAGCCCCCTCGTGCCAGCCGTCGAGCTCCAGCCCTTGAACGCCAGCGATCCTTGCG
GTCCCAGCCTCGAATACGACGCGGAGTACGCCGTGCTGCTCTCGCGCATGTCACCGCGCGGTGACGCGCA
ATACGGGCAGTTCGTCGGAACGCCGGAAGCGCCGAACTGGGCCGAGATCGAGCGCGATTGCCGCCGCCTG
CTGCTGCGGACCCGGGACATCAACCTCTTCGTCTGGCTGTGCCGGGCACGTACAAGGGTGGCGCAGGCAG
CGGGGCTAGCGCAGTCGTTGGCCGTGCTGTCCGAGGTGCTGGAGCGCTGGCCCGACGCGGTGCATCCGCA
GCTTGTTGTAGAGGGGGAGCGTGATCCCGCGGTCCGCGCCAATGCCTTGGCGGCGCTGGCGGATCCCGAT
GGATTGCTGGGTGATGTGCGGGAGATCGTCGTCGCAGCCAATGCCGCGAGGCATTTGACGGTGCGCGAAA
TCGAGCGTGCCAGGTCGGTACCTCGCCTGGTCGACGCGCCGAGTCCTGAGTCGGTCGCCCAGCAGCTCGC
CCAACTGCGTCTGGCTGCGAATGGAGATGCCGATGCGCCGGTGAACCTGTTGTCGGAGGCACTGCGGGCA
ACCCGGCAGATCGCTGAATGGGCGGTACGCCAACTGGGTGGGGACGCGCCTTCGCTCCAGGCGCTGATCG
ACCTCCTGAAACCGTTCGACGAAATCGACGTGGTCCGGCGTACCGAGCCCGTCTCGCCTCGCGAAGGCGT
CCTGCGCCCGAGCGTTTCCGGTCTTGCTTCGCGCGACGACGCGCTTCAGGCGATTCGCAGCGCACGCCAG
TGGTTCGAAAACCACGAACCCAGCAGCCCGGTGGCGGTGTTGCTCAAGCAGGCCGAGCGCATGGTCGGCC
AGCGTTTCGCGCTGGTGGCCAATGCCATTCCGCTCGATCTGTTGCAGAAATGGGATTCAGAGGGGGAACG
TGTTTGA