SecReT6
Protein ID: 319793923
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3267
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3516299..3517456 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDE6VB03
KEGG IDvpe:Varpa_3267
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.60E-97, Aligned region: 19..337
Protein Sequence: 385 a.a.     [Download]
>gi|319793923|ref|YP_004155563.1| type VI secretion protein [Variovorax paradoxus EPS]
MRQSPAKPALQEMFTRLRDAPWKFGFFAVLRRIGAACSPHPPIGLASRPQQESFRLGQVAALIFAPREIA
GAALPGELQPAFPGAALPRPGNNPDLPTVRVYGLGLLGPNGPLPLHYTELIRDRVENYNDSTLADFLDLF
HHRYLTHMYRAWAQSQAAAGLDRAEDEAFSRYVARLTGHDPLEIRDSALPTHARLAASTHLTREARNPDG
LAATLARFFAVPVQLQEFVLHWIRIDDEDQCHLGQARASSVMAMGAIAGEVVADRQNKFRLVIGPLTLDQ
YLRFTPHGRDLPLLVEWVRGFIGYEFVWEVELRLRNDSTPPARLDDSEKLGWSTWLGGSKGQAAQVVGFT
VGMVFEPEQYIGSRHRSDTQATQVTQATQATQAVH
 
Nucleotide Sequence: 1158 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3517456-3516299 Variovorax paradoxus EPS chromosome, complete genome
GTGAGGCAATCTCCCGCGAAGCCCGCGTTGCAGGAAATGTTCACGCGATTGCGCGATGCGCCCTGGAAGT
TCGGCTTCTTTGCCGTATTGAGGCGCATCGGTGCGGCTTGTTCGCCGCACCCCCCGATCGGGCTCGCCAG
CCGTCCGCAGCAAGAGTCCTTTCGATTGGGACAGGTGGCGGCATTGATATTCGCGCCGCGCGAAATCGCC
GGTGCGGCGCTGCCGGGCGAGCTGCAACCGGCCTTCCCAGGCGCGGCGCTGCCGCGCCCGGGAAACAATC
CGGACTTACCCACGGTGCGCGTGTACGGCCTGGGTCTCCTGGGTCCCAACGGACCGCTTCCGCTGCACTA
CACGGAGTTGATCCGCGACCGTGTCGAGAACTACAACGACAGCACATTGGCGGACTTCCTGGACCTTTTC
CACCATCGCTACCTGACGCACATGTACCGCGCATGGGCGCAGAGCCAGGCGGCGGCGGGACTGGACCGTG
CCGAGGACGAGGCCTTCAGTCGCTACGTAGCTCGCCTCACGGGGCATGACCCGCTGGAGATCCGCGACTC
GGCATTGCCAACGCATGCCCGTCTCGCCGCCTCCACGCACCTGACCCGGGAGGCACGCAACCCCGACGGA
TTGGCTGCGACGCTCGCCCGCTTCTTTGCCGTACCCGTGCAGCTCCAGGAGTTCGTGCTGCATTGGATTC
GGATCGACGACGAAGACCAGTGCCATCTGGGGCAGGCACGCGCTTCCAGCGTCATGGCGATGGGGGCGAT
TGCGGGAGAGGTCGTGGCCGATCGGCAGAACAAGTTCCGGCTGGTGATCGGTCCATTGACGCTCGACCAG
TACCTGCGCTTTACCCCTCACGGGCGAGACCTCCCGTTGCTCGTCGAATGGGTGCGGGGTTTCATCGGCT
ACGAGTTTGTCTGGGAGGTCGAGCTGCGCCTGCGCAACGACAGCACGCCGCCCGCCCGGCTCGACGATTC
GGAAAAGCTCGGATGGTCTACGTGGCTGGGCGGCTCGAAGGGCCAAGCCGCACAAGTTGTCGGCTTCACC
GTGGGAATGGTGTTCGAGCCCGAGCAATACATCGGCTCGCGCCATCGCAGCGATACCCAAGCCACCCAGG
TCACCCAGGCCACCCAGGCCACCCAGGCCGTTCATTGA