SecReT6
Protein ID: 319793927
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3271
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3523295..3524671 [-]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDE6VB07
KEGG IDvpe:Varpa_3271
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-59, Aligned region: 62..272
OmpA [PF00691], Evalue: 1.20E-17, Aligned region: 336..434
Protein Sequence: 458 a.a.     [Download]
>gi|319793927|ref|YP_004155567.1| DotU family type IV/VI secretion system protein [Variovorax paradoxus EPS]
MKPFVEDPMHNQEEPQDDSRGLDPSADPSSNDSWAGDPDKGVHLAPEPSMQVRLLAVTAARNPLLEAAQP
LLRALADMPATLGNEGVTILHQLLEREVASFQSLCGSAQIRHEHAVAASYSLCTALDEAANSTEWGGGKN
GEAGIWAGQQLAAKFHGDTKGGDKFFLLVGRLAASPQEHIDLLELMYQVLGLGFEGRFGTATNGRRQLET
VRHRLFTLLGTARGEVPRDLSPHWKGVGAGTFRLLRSIPVWLTVSLLTLVLCGLFAWYKYQLLQTSADVE
QRIAAIGRMRPPPAPPAPAVKPLRLKELLASEIARGTVSVDEDEHRSAVSFRGDDMFVPGQARLNAKILP
VLDKVADEINQVSGSVQVTGHSDNRPIKTREFPNNQVLSEKRADAVTAVLLGKGVVASRIRTEGRGDTMP
VADSATAAGRARNRRVDIVVIQGDGGSAASPAAKPAAR
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3524671-3523295 Variovorax paradoxus EPS chromosome, complete genome
ATGAAACCCTTTGTCGAAGATCCCATGCACAACCAGGAAGAGCCCCAAGACGACTCGAGAGGGCTCGATC
CGTCTGCCGACCCTTCATCCAACGACTCCTGGGCGGGCGATCCGGATAAGGGTGTGCATCTTGCCCCCGA
GCCATCGATGCAAGTGCGTCTGCTCGCGGTCACTGCCGCCAGGAATCCCCTGCTCGAAGCCGCGCAGCCG
CTGCTGCGCGCACTCGCCGACATGCCGGCGACGCTCGGCAATGAGGGCGTCACGATCCTGCATCAGCTGC
TGGAGCGCGAGGTCGCGAGCTTTCAATCGCTCTGCGGCAGCGCGCAGATCAGGCACGAACATGCGGTCGC
GGCCAGCTATTCGCTGTGCACCGCACTCGACGAGGCGGCCAACAGCACGGAGTGGGGCGGCGGCAAGAAT
GGCGAAGCCGGCATCTGGGCCGGACAGCAACTGGCTGCGAAATTCCACGGTGACACGAAGGGCGGCGACA
AGTTCTTCCTGCTGGTCGGCCGGCTGGCCGCCAGTCCGCAGGAGCACATCGATCTGCTCGAGCTGATGTA
CCAGGTCCTTGGGCTGGGCTTCGAGGGACGCTTTGGCACTGCGACCAACGGGCGCCGGCAGTTGGAGACG
GTTCGCCATCGGCTCTTCACGCTGCTTGGTACGGCGCGCGGCGAAGTCCCGCGCGATCTTTCCCCGCACT
GGAAGGGTGTGGGTGCGGGCACGTTCCGCCTGTTGCGCAGCATTCCGGTGTGGCTGACGGTGTCGCTGCT
GACATTGGTCTTGTGCGGCCTGTTCGCCTGGTACAAGTACCAGCTGTTGCAGACCAGCGCCGACGTGGAG
CAACGCATCGCCGCCATCGGCCGGATGCGTCCGCCACCCGCACCGCCAGCGCCTGCGGTCAAACCGCTGC
GCCTGAAAGAGCTGCTGGCGTCCGAGATTGCACGCGGGACCGTGAGCGTGGATGAAGACGAGCACCGAAG
CGCGGTCTCGTTCAGGGGTGACGACATGTTCGTCCCCGGCCAGGCGCGTCTGAACGCAAAGATTCTTCCG
GTCCTGGACAAGGTGGCGGACGAGATCAACCAGGTTTCGGGCTCCGTCCAGGTCACCGGCCACTCCGACA
ACCGCCCGATCAAGACCCGCGAGTTCCCCAACAACCAGGTCTTGAGCGAGAAGCGGGCCGACGCAGTGAC
TGCCGTGCTGCTGGGCAAGGGCGTGGTGGCGTCGCGCATCCGTACCGAAGGGCGCGGCGACACGATGCCG
GTGGCCGACAGCGCAACGGCGGCTGGGCGCGCCAGGAATCGCCGTGTCGACATCGTCGTCATTCAGGGCG
ACGGCGGTAGCGCCGCGTCGCCCGCCGCAAAGCCGGCGGCGCGCTAG