SecReT6
Protein ID: 319793928
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3272
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3524668..3526023 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDE6VB08
KEGG IDvpe:Varpa_3272
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-144, Aligned region: 20..449
Protein Sequence: 451 a.a.     [Download]
>gi|319793928|ref|YP_004155568.1| type VI secretion protein [Variovorax paradoxus EPS]
MSWYNKVAWSEGLFLRPQLFQQQERYLEHLAHKRTASLSPFYWGFNHYSIDAESLSLGKLVLASAAGIFS
DGTPFDAPGQTLPPAPLTIQPEHLEQVIHLAVPIRTPNGEETTFDDAMAAAASLARFSVFDTELRDANSI
GQGPKTVQLSRLRLRLLPQRELTDAWIGLPLAKVTVLRSDGSIATDPYLIPPVAGYGASPLLADWMTNLH
GLCRLRAQTLAARLSGNDGKSSESAEVSDFLLLQILNRYEPLFEHWLRVRETSPEVLYTALCSLSGELAT
FVRASTRRPTEHPAYRHIDPCLSFRGLIADVQALLNDVLVRSAQSIPLANRANGVRVASVEPSELQGFSS
LVFAVAAHTPPDQLASEFPARCKVGPSDRLGELIRSHLPGIPLQTLPVPPRQIPFNAGFVYFQIDSRGPL
WEHMVKHGGLALHVAGEFPGLRLELWGIREK
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3526023-3524668 Variovorax paradoxus EPS chromosome, complete genome
ATGAGTTGGTACAACAAAGTCGCCTGGAGCGAAGGACTCTTCCTGCGCCCGCAGCTGTTCCAGCAGCAGG
AGCGCTATCTCGAACACCTCGCGCACAAGCGCACGGCCTCGCTCAGTCCGTTCTACTGGGGCTTCAATCA
CTACAGCATCGATGCGGAGTCCCTGTCCCTTGGCAAGCTGGTGCTTGCCAGTGCCGCAGGCATTTTTTCG
GACGGCACCCCCTTCGACGCCCCCGGCCAGACGCTGCCGCCCGCGCCGCTCACCATCCAGCCGGAGCATC
TGGAGCAGGTCATCCATCTGGCCGTGCCCATTCGCACGCCCAATGGCGAGGAAACGACTTTCGACGACGC
GATGGCTGCTGCTGCGTCGCTCGCACGCTTCTCGGTCTTCGACACCGAGTTGCGCGACGCGAATTCCATC
GGGCAGGGCCCGAAGACGGTGCAGCTTTCGCGCCTTCGCTTGCGTCTGCTTCCGCAACGGGAGCTGACCG
ATGCCTGGATCGGTCTTCCGCTCGCCAAGGTGACGGTGCTGCGTTCCGATGGGAGCATCGCCACCGATCC
GTATCTGATCCCGCCCGTCGCCGGCTACGGTGCGAGCCCGCTGCTGGCCGACTGGATGACGAATCTGCAC
GGCCTGTGCCGTCTCCGCGCGCAAACGCTCGCGGCACGGCTCAGCGGCAATGACGGCAAGTCGAGCGAAT
CGGCCGAAGTGTCCGATTTCCTGCTGCTGCAGATACTCAATCGCTACGAGCCCTTGTTCGAGCACTGGCT
GCGTGTGCGAGAGACCTCGCCGGAGGTGCTGTACACCGCCTTGTGCTCTCTCAGCGGAGAGCTTGCGACG
TTCGTGCGGGCGAGCACGCGTCGCCCCACCGAGCACCCGGCCTATCGGCACATCGATCCGTGTTTGTCTT
TCAGGGGGCTGATAGCCGATGTACAGGCCTTGCTCAACGATGTACTGGTTCGCAGTGCGCAAAGTATTCC
CCTCGCCAATCGCGCCAACGGCGTGCGCGTGGCAAGCGTCGAGCCCTCGGAGCTGCAAGGCTTCTCGAGC
CTCGTGTTCGCCGTGGCGGCTCATACACCGCCCGATCAGCTGGCCAGCGAGTTTCCGGCGCGCTGCAAGG
TCGGGCCGAGCGATCGGCTCGGCGAACTCATCCGCTCGCATCTGCCCGGCATTCCGCTGCAAACGCTGCC
GGTGCCGCCGCGCCAGATCCCTTTCAACGCGGGCTTTGTCTACTTTCAGATCGACTCGCGCGGGCCGTTG
TGGGAGCACATGGTCAAGCACGGTGGACTGGCGTTGCATGTGGCGGGTGAGTTCCCTGGTTTGCGTCTTG
AGCTCTGGGGCATCCGAGAGAAATGA