SecReT6
Protein ID: 319793929
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3273
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3526056..3526613 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE6VB09
KEGG IDvpe:Varpa_3273
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-36, Aligned region: 37..179
Protein Sequence: 185 a.a.     [Download]
>gi|319793929|ref|YP_004155569.1| type VI secretion lipoprotein [Variovorax paradoxus EPS]
MSFNVPCPRRTASRQWLFVVLSLLVLALALATAQPSHAQFSYPREQTKLDITITAEAGVNPDDKGRAAPI
LVRIYELKSEGVFEAADYFSLSSNDKALIGSELLVRDEFILRPGDVKTIRRKSHPDLAAIGVVAGYRDLA
QADWRAVQKIDPAPEVAWYRSVLPANKLKLQIDLQAKGIQLTPLK
 
Nucleotide Sequence: 558 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3526613-3526056 Variovorax paradoxus EPS chromosome, complete genome
ATGTCATTCAATGTGCCTTGTCCCCGGCGAACCGCCTCACGGCAATGGCTTTTCGTGGTGCTCTCGTTGC
TCGTTCTGGCGCTCGCACTGGCCACGGCGCAGCCCTCGCATGCCCAGTTCTCCTACCCGCGAGAGCAGAC
AAAGCTCGATATCACGATCACGGCGGAGGCCGGCGTCAATCCCGACGACAAGGGCCGGGCGGCGCCCATC
CTGGTGCGCATCTACGAACTCAAGTCGGAAGGCGTCTTCGAAGCCGCCGACTACTTTTCGCTCTCCAGCA
ATGACAAGGCCCTGATCGGCAGCGAGCTGCTCGTTCGAGACGAATTCATCCTGCGGCCCGGCGATGTCAA
GACCATCCGCCGCAAATCGCACCCCGACCTTGCGGCCATCGGTGTCGTCGCCGGCTACCGCGATCTCGCG
CAAGCCGATTGGCGAGCGGTGCAAAAGATCGATCCCGCACCGGAAGTCGCCTGGTATCGCTCGGTCCTGC
CGGCGAACAAGCTCAAGTTGCAGATCGACCTTCAAGCCAAGGGCATCCAGCTCACCCCCCTCAAATAG