SecReT6
Protein ID: 319793931
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3275
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3527356..3528858 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDE6VB11
KEGG IDvpe:Varpa_3275
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-190, Aligned region: 68..494
Protein Sequence: 500 a.a.     [Download]
>gi|319793931|ref|YP_004155571.1| EvpB family type VI secretion protein [Variovorax paradoxus EPS]
MNTTSDAVLDAPVTAQYANPSDFASLLDKEFKPKTDEARDAVEAAVRTLAEQALVNAATMTDDAYSSIEA
IIAEIDRKLSEQINLVLHKDDFQKVESAWRGMHHLVYNTETDEKLKIRFMDVSKDEVRRTLRRHKGIAWD
QSPIFKRIYEEEYGQLGGEPYGCLVADYYFDHTPPDVELLGAIAKISAASHAPFIAGSAPSLLGMESWQE
LANPRDLAKITSNLEHAPWNSLRNTEDSRYVGLAMPRFLARLPYGAKINPVDEFDFEEETEGADHRNYVW
SNAAYAMAVNINRSFKLYGWCTMIRGVESGGTVENLPCHTFPTDDGGFDMKCPTEIAISDRREAELAKAG
LIPLVHRKNTDHAAFIGAQSMQKPQEYMDPDATANANLSARLPYLFASTRFAHYLKCIVRDKIGSFKERE
DMQRWLNEWIMHYVDADPANSSQETKARRPLAAAEVVVEDIEGNPGYYSAKFFLRPHFQLEGLTVSLRLV
AKLPSLKEAA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3528858-3527356 Variovorax paradoxus EPS chromosome, complete genome
ATGAACACCACAAGCGATGCCGTGCTCGACGCGCCGGTCACGGCGCAATACGCCAACCCTTCCGACTTTG
CGTCCCTGCTGGACAAGGAGTTCAAGCCCAAGACCGATGAGGCTCGCGACGCCGTCGAGGCAGCCGTTCG
GACCTTGGCCGAGCAGGCGCTCGTCAATGCCGCGACGATGACCGACGATGCCTACAGCAGCATCGAGGCC
ATCATTGCGGAGATCGATCGAAAGCTTTCGGAGCAGATCAATCTCGTGCTGCACAAGGACGACTTCCAGA
AGGTCGAGTCGGCCTGGCGCGGCATGCACCACCTGGTCTACAACACCGAAACGGACGAGAAGCTCAAGAT
CCGTTTCATGGACGTGTCGAAGGATGAGGTGCGCCGCACGCTTCGTCGCCACAAGGGCATTGCCTGGGAC
CAGAGTCCGATCTTCAAGCGCATCTACGAGGAAGAGTACGGACAACTCGGTGGCGAGCCCTATGGTTGCC
TCGTGGCGGATTACTACTTCGACCACACGCCGCCCGATGTCGAACTGCTCGGCGCCATTGCCAAGATTTC
GGCCGCATCGCATGCGCCGTTCATCGCGGGATCGGCACCTTCGTTGCTCGGCATGGAGTCGTGGCAAGAA
CTTGCGAATCCCCGTGACCTCGCGAAGATCACCTCGAATCTCGAGCATGCCCCCTGGAATTCGTTGCGCA
ACACCGAAGACTCGCGCTACGTCGGTCTCGCCATGCCGCGTTTTCTCGCGCGCTTGCCCTATGGCGCAAA
GATCAACCCGGTCGACGAGTTTGATTTCGAAGAGGAAACCGAAGGCGCCGATCATCGGAACTACGTCTGG
AGCAACGCGGCCTATGCCATGGCCGTCAACATCAACCGCAGTTTCAAGCTTTACGGCTGGTGCACGATGA
TCCGCGGCGTGGAGTCGGGCGGCACGGTGGAAAACCTGCCATGCCACACCTTCCCGACCGACGACGGCGG
CTTCGATATGAAGTGCCCGACCGAGATCGCCATCTCGGACCGCCGCGAAGCCGAGCTCGCCAAGGCAGGC
CTGATTCCGCTGGTGCATCGGAAGAACACCGATCACGCTGCCTTCATCGGTGCGCAATCGATGCAGAAGC
CGCAGGAGTACATGGATCCGGATGCGACGGCCAATGCCAATCTGTCGGCCCGCCTGCCGTACCTGTTCGC
GAGCACCCGTTTCGCACACTACCTCAAGTGCATCGTTCGCGACAAGATCGGTTCCTTCAAGGAGCGCGAG
GACATGCAGCGCTGGCTCAACGAATGGATCATGCATTACGTCGATGCCGATCCCGCCAACTCGTCGCAGG
AAACCAAGGCGCGCAGGCCGCTCGCGGCGGCTGAAGTCGTTGTGGAAGACATCGAGGGCAACCCCGGCTA
CTACAGCGCGAAGTTCTTCCTGCGCCCGCATTTCCAGCTCGAAGGCTTGACCGTTTCATTGCGCCTCGTC
GCAAAGTTGCCGTCTCTCAAAGAGGCGGCCTGA