SecReT6
Protein ID: 319793932
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3276
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3528880..3529425 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDE6VB12
KEGG IDvpe:Varpa_3276
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-61, Aligned region: 11..164
Protein Sequence: 181 a.a.     [Download]
>gi|319793932|ref|YP_004155572.1| type VI secretion protein [Variovorax paradoxus EPS]
MTNNNSSQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMGVLADLSGKPTQALPPVADRKFLDIDIDNF
DERMKAIQPRVAFAVPNTLSGQGQLMVDITFESIDDFSPAAVARKVEPLSRLLEARTQLANLQTYMDGKA
GAEGLLNKLLQDPALMKSLAQAPKPRAATDHNDAPTADSAA
 
Nucleotide Sequence: 546 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3529425-3528880 Variovorax paradoxus EPS chromosome, complete genome
GTGACAAACAACAACAGCAGTCAGAAATTCATCGCCCGCAACAGGGCCCCACGCGTGCAGATCGAATACG
ACGTGGAAATCTACGGCTCGGAGAAAAAGATCGAACTGCCTTTCGTCATGGGTGTGCTGGCCGATCTTTC
CGGCAAACCCACCCAGGCGTTGCCGCCGGTGGCCGACCGCAAGTTCCTCGACATCGACATCGACAACTTC
GACGAGCGCATGAAGGCGATCCAGCCGCGCGTGGCCTTCGCCGTGCCCAACACGCTGTCGGGCCAAGGCC
AGCTCATGGTCGACATCACCTTCGAGAGCATCGATGACTTCTCGCCGGCCGCCGTGGCCCGCAAGGTCGA
GCCATTGAGCCGGCTGCTCGAGGCGCGCACCCAACTTGCCAATCTCCAGACCTACATGGACGGCAAGGCC
GGTGCCGAAGGCCTGCTCAACAAGCTGCTGCAAGACCCCGCGCTCATGAAGTCGTTGGCGCAGGCTCCCA
AGCCCCGCGCGGCAACAGATCACAACGACGCACCGACTGCCGACTCGGCGGCGTGA