SecReT6
Protein ID: 319793933
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3277
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3529484..3532189 [-]
Producttype VI secretion ATPase, clpv1 family
NoteTssH
UniProt IDE6VB13
KEGG IDvpe:Varpa_3277
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.80E-40, Aligned region: 231..311
AAA_2 [PF07724], Evalue: 2.80E-40, Aligned region: 620..787
AAA [PF00004], Evalue: 3.20E-22, Aligned region: 233..364
AAA [PF00004], Evalue: 3.20E-22, Aligned region: 626..710
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 233..311
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 383..402
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 625..737
ClpB_D2-small [PF10431], Evalue: 3.60E-13, Aligned region: 793..871
AAA_16 [PF13191], Evalue: 2.30E-11, Aligned region: 210..250
AAA_16 [PF13191], Evalue: 2.30E-11, Aligned region: 274..311
AAA_16 [PF13191], Evalue: 2.30E-11, Aligned region: 334..399
AAA_16 [PF13191], Evalue: 2.30E-11, Aligned region: 470..486
AAA_16 [PF13191], Evalue: 2.30E-11, Aligned region: 593..645
AAA_16 [PF13191], Evalue: 2.30E-11, Aligned region: 690..715
AAA_16 [PF13191], Evalue: 2.30E-11, Aligned region: 766..804
AAA_22 [PF13401], Evalue: 7.40E-08, Aligned region: 233..317
AAA_22 [PF13401], Evalue: 7.40E-08, Aligned region: 366..402
AAA_22 [PF13401], Evalue: 7.40E-08, Aligned region: 624..645
AAA_22 [PF13401], Evalue: 7.40E-08, Aligned region: 687..714
AAA_25 [PF13481], Evalue: 6.50E-07, Aligned region: 233..257
AAA_25 [PF13481], Evalue: 6.50E-07, Aligned region: 369..396
AAA_25 [PF13481], Evalue: 6.50E-07, Aligned region: 621..652
AAA_19 [PF13245], Evalue: 3.80E-06, Aligned region: 231..256
AAA_19 [PF13245], Evalue: 3.80E-06, Aligned region: 622..647
Sigma54_activat [PF00158], Evalue: 7.10E-06, Aligned region: 227..249
Sigma54_activat [PF00158], Evalue: 7.10E-06, Aligned region: 625..724
NACHT [PF05729], Evalue: 5.20E-05, Aligned region: 233..260
NACHT [PF05729], Evalue: 5.20E-05, Aligned region: 625..659
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 225..292
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 625..645
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 224..251
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 623..650
AAA_14 [PF13173], Evalue: 0.0001, Aligned region: 233..314
AAA_14 [PF13173], Evalue: 0.0001, Aligned region: 624..724
Zeta_toxin [PF06414], Evalue: 0.00035, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 0.00035, Aligned region: 504..504
Zeta_toxin [PF06414], Evalue: 0.00035, Aligned region: 617..665
AAA_17 [PF13207], Evalue: 0.00038, Aligned region: 233..251
AAA_17 [PF13207], Evalue: 0.00038, Aligned region: 625..661
TIP49 [PF06068], Evalue: 0.00047, Aligned region: 233..255
TIP49 [PF06068], Evalue: 0.00047, Aligned region: 281..313
TIP49 [PF06068], Evalue: 0.00047, Aligned region: 594..661
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 212..246
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 285..317
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 624..637
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 696..707
AAA_18 [PF13238], Evalue: 0.0018, Aligned region: 233..252
AAA_18 [PF13238], Evalue: 0.0018, Aligned region: 626..650
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 231..249
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 302..313
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 593..646
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 693..718
AAA_23 [PF13476], Evalue: 0.0046, Aligned region: 233..261
AAA_23 [PF13476], Evalue: 0.0046, Aligned region: 477..540
AAA_23 [PF13476], Evalue: 0.0046, Aligned region: 623..652
RNA_helicase [PF00910], Evalue: 0.0061, Aligned region: 186..202
RNA_helicase [PF00910], Evalue: 0.0061, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.0061, Aligned region: 626..647
Protein Sequence: 901 a.a.     [Download]
>gi|319793933|ref|YP_004155573.1| type VI secretion ATPase, clpv1 family [Variovorax paradoxus EPS]
MAISRRALFGKLNLTLFRGIEAATAFAKLRGNPYVELTHWIHQIWQINDSDLHRICRHYQIDFQVVEKDL
ISRLSELPSGATSLSDFSHHVETAIERAWILSSLEFGDRRVRSAWLLAALVQTPDLRRLLLGVSPAFRKL
PVEQLMDDVISLIAGSPEDNEGSHDGLGLPAAMPGEASGAIADSPDGKSALARYCRDLTDSARGGEIDPV
IGREHEIRTMVDILLRRRQNNPLLTGEAGVGKTAVVEGLALAIANGEVPPSLRDARLLSLDVGALLAGAS
MRGEFESRLKSLLEEASKSSQPVVLFIDEVHTLIGAGGQAGTGDAANLLKPALARGTLRTIGATTWSEYK
RHIEKDPALTRRFQTLQVAEPEEASAVEMVRGLVAVFAEHHGVTVLDEAVRAAVSLSHRYIPSRQLPDKA
ISLLDTACARVAMSLHTPPAVVDQLRQRIAALDVELALLAQESAISRGSDARSKRFEAANARLDATEHEL
STYEARWQEELAMVQQIQSLRTKKREEKGGRESGAEGEWPSARLHALEEELLLRQQDSPLVLSQVDESVI
AAIVADWTGIPVGRMVQDEVAAVFRLEATLGERVVGQDRALAAIAERIRVSRARLTDPNKPVGVFLLAGP
SGVGKTETALALADAMYGGEQNLITINMSEFLEPHTVSTLKGSPPGYVGYGEGGVLTEAVRRKPYSVILL
DEVEKAHPDVHEIFYQVFDKGWMEDGEGRRIDFRNTTILLTSNAGAELIESLCEDPASSPEVETLREALQ
PVLRQVFPAAFLGRLSVVPYLPLGAQALGRIVSLHLDHVVHRMKKQHGIELQYGPGLVAEIVDRCGTHET
GARRLTGFIEQNLLPVLSRQWLNALQEKRTIVRISVDARPLGKTGPRSQEGDVVTCHTEYV
 
Nucleotide Sequence: 2706 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3532189-3529484 Variovorax paradoxus EPS chromosome, complete genome
ATGGCGATCTCCCGACGGGCGTTGTTCGGCAAGCTCAATCTCACCCTGTTTCGCGGCATTGAAGCCGCAA
CAGCATTTGCCAAGCTGAGAGGAAATCCATATGTCGAATTGACGCACTGGATTCATCAAATCTGGCAAAT
CAATGACAGCGATTTGCATCGCATCTGCCGCCATTACCAAATTGATTTTCAGGTTGTCGAAAAAGATCTG
ATTTCCAGATTGTCGGAATTGCCCTCGGGCGCGACATCGCTGAGCGATTTTTCCCATCACGTCGAAACGG
CCATCGAGCGCGCCTGGATTCTCTCCAGCCTCGAATTCGGCGATCGTCGTGTGCGCAGTGCGTGGCTGCT
TGCGGCGTTGGTGCAAACGCCAGATCTGCGGCGGCTGCTCCTTGGCGTATCGCCCGCCTTCCGAAAGCTC
CCGGTCGAGCAGTTGATGGATGACGTCATTTCCCTCATCGCAGGCTCCCCGGAAGACAACGAAGGGTCGC
ACGATGGCTTGGGCCTCCCGGCCGCAATGCCAGGAGAAGCGAGCGGCGCGATCGCCGATTCGCCGGACGG
CAAATCCGCCCTGGCGCGGTATTGCCGAGACCTGACCGACAGCGCGCGCGGCGGCGAAATCGATCCGGTG
ATCGGCCGCGAACACGAGATCCGCACGATGGTCGACATCCTGCTGCGCCGGCGGCAGAACAACCCTCTGC
TCACCGGAGAGGCCGGGGTGGGCAAGACAGCCGTGGTCGAAGGACTCGCGCTGGCAATCGCCAACGGCGA
GGTTCCGCCCTCGCTGCGCGATGCTCGCCTGCTCAGTCTCGATGTAGGTGCGTTGCTCGCTGGTGCCAGC
ATGCGGGGGGAGTTCGAGTCCCGTCTGAAGTCTCTGCTCGAAGAAGCGAGCAAGTCGAGTCAGCCGGTCG
TTCTTTTCATCGACGAGGTGCACACCCTGATCGGTGCCGGCGGACAGGCTGGTACCGGAGATGCAGCCAA
TCTGCTCAAGCCTGCTCTCGCACGCGGCACCTTGCGCACCATCGGCGCGACCACGTGGAGCGAATACAAG
CGCCATATCGAGAAGGACCCTGCGTTGACCCGTCGTTTTCAGACGCTGCAGGTCGCCGAGCCGGAGGAGG
CCTCGGCCGTCGAAATGGTGCGCGGGCTGGTCGCCGTCTTTGCCGAACATCACGGTGTCACGGTGCTGGA
CGAGGCGGTGCGGGCGGCGGTGTCCCTGTCCCATCGCTACATTCCGTCGCGCCAGTTGCCGGACAAGGCC
ATCAGCCTGCTCGACACGGCCTGTGCACGTGTCGCCATGTCGCTGCACACGCCACCCGCCGTGGTCGATC
AACTGCGCCAGCGAATCGCAGCCCTGGACGTGGAACTCGCCTTGCTGGCTCAGGAAAGCGCGATCTCGCG
GGGAAGTGATGCCCGATCAAAGCGCTTCGAAGCGGCAAACGCCCGACTCGATGCCACCGAACACGAACTG
TCGACCTACGAGGCCCGGTGGCAAGAAGAGCTTGCGATGGTTCAGCAGATTCAATCGCTGAGAACAAAGA
AGAGGGAGGAGAAGGGGGGGAGGGAGAGTGGCGCCGAGGGCGAGTGGCCCTCGGCGCGACTGCATGCTCT
GGAAGAAGAGCTCCTGTTGCGCCAACAGGACTCGCCATTGGTTCTTTCTCAGGTCGACGAGTCGGTGATC
GCGGCCATCGTTGCGGATTGGACTGGGATACCCGTGGGCCGAATGGTGCAAGACGAAGTTGCCGCGGTCT
TCAGGCTCGAAGCCACTCTCGGCGAACGCGTCGTCGGCCAGGACCGCGCGCTTGCCGCGATTGCGGAGCG
CATCCGTGTGTCGCGGGCGCGGCTGACCGATCCGAACAAGCCGGTCGGCGTCTTCCTGCTGGCCGGTCCA
TCAGGCGTCGGAAAGACCGAAACCGCGTTGGCACTTGCGGACGCCATGTATGGCGGCGAGCAGAACCTCA
TCACCATCAACATGAGCGAGTTCCTGGAGCCGCACACCGTCTCGACACTGAAGGGCTCGCCGCCGGGCTA
CGTGGGCTACGGAGAAGGCGGTGTTCTGACGGAGGCCGTGCGCCGGAAGCCCTACAGCGTGATCCTGCTC
GACGAGGTGGAAAAGGCGCATCCGGACGTCCACGAAATCTTCTACCAGGTGTTCGACAAAGGCTGGATGG
AAGACGGTGAAGGCCGCCGCATCGACTTCAGAAACACCACCATCCTGTTGACGAGCAACGCAGGTGCGGA
ACTCATCGAGAGCCTGTGCGAAGACCCCGCATCGTCGCCCGAAGTCGAAACCCTGCGCGAAGCGCTCCAG
CCTGTTCTTCGCCAGGTTTTCCCGGCCGCATTCCTGGGGCGCCTGTCCGTCGTGCCTTATCTGCCATTGG
GTGCGCAGGCCCTGGGTCGCATCGTCTCGCTGCATCTGGACCATGTGGTGCATCGGATGAAAAAGCAGCA
TGGCATCGAATTGCAATACGGCCCCGGCTTGGTGGCCGAAATCGTCGATCGATGCGGCACGCATGAAACC
GGGGCACGCCGACTGACGGGCTTCATCGAGCAGAACCTGCTCCCGGTCTTGTCGCGGCAGTGGCTCAACG
CCTTGCAGGAAAAGCGAACGATCGTCCGGATATCTGTCGACGCAAGGCCACTCGGGAAAACAGGGCCGCG
TTCGCAGGAAGGAGATGTCGTCACCTGCCATACCGAGTACGTCTGA